Conserved Protein Domain Family
Gp58

?
pfam07902: Gp58 
gp58-like protein
Sequences found in this family are derived from a number of bacteriophage and prophage proteins. They are similar to gp58, a minor structural protein of Lactococcus delbrueckii bacteriophage LL-H.
Statistics
?
PSSM-Id: 336858
View PSSM: pfam07902
Aligned: 7 rows
Threshold Bit Score: 710.186
Threshold Setting Gi: 81533555
Created: 24-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81533555    1 MSRDPTYTINEHDLSF-ADGRFYVTFKADKSSETVRLNSS-CLGNTIIKKLQVEDDNTMHDFVKPKVT--TQQAFGLAQQ 76
gi 123073691   1 MSRDPTLTLDESNLVIgKDGRVHYTFTASQDNQTVRLASN-CLGTAHFNQLMIERGDKATGYVAPVVVegSGESTGVFKS 79
gi 81533719    1 MSRDPTLTLDESNLVIgKDGRVHYTFTASQDNQTVRLASN-CLGTAHFNQLMIERGDKATGYVAPVVVegSGELTGVFKS 79
gi 122152232   1 MSRDPTLLIDESNLTIgSDGRAYYTFTADGDTKSVKIANNkCIGTTRFNQLMIERGGKPTNYVAPVVVegTGNPTGLFKD 80
gi 126011112   1 MSRDPTLLIDESNLTIgSDGRAYYTFTADGDTKSVKIANGkCIGTTRFSQLMIERGNKPTSYVAPVVVegSGESTGLFKN 80
gi 157311179   1 MSRDPTLTLDESNLTIgSDGRVHYTFTASQDNQKVRLASN-CLGTTRFNQVMIERGDKATDYVAPVVVegSGESTGVFKS 79
gi 489078853   1 MSRDPTLLIDESNLTIgSDGRAYYTFKADGDTKSVKLANNkCIGTTRFNQLMIERGGKPTNYVAPVVVegSGESTGLFKN 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81533555   77 -------VKELDLQLKDPK-SDLWGKIKFNNKAMLVEYANKEMSSAIAQSAEQILLQVK--------------------- 127
gi 123073691  80 leemlsgLQSINLELTDTKnSNLWSKIKLTTNGMLREYHRDNITTEIIEKADGIATRISedsdkklalin---------- 149
gi 81533719   80 leemlssLRSINLELTDTKdSKLWSKIKLTNRGMLQEYYDGKIKTEIVNSAQGVATRITeetgkklalin---------- 149
gi 122152232  81 -------LKEISLELTDTKnSKLWSKIKLNNQGMIEEYYNGTIKSEIIKTAEGTQQRISsetdkklalin---------- 143
gi 126011112  81 legalsqLKELNLELTDTEkSNLWAKIKLNNRGMLQTYFDTTIKNEILTTARGIKETISdterglqseflktvqgqriql 160
gi 157311179  80 leemlsgLQSINLELTDTKnSNLWSKIKLTTNGMLREYHRDHIKTEIVESADGIAKRIAddtgqklalin---------- 149
gi 489078853  81 legalsqLKELNLELTDTVnSQLWAKIKLTTNGMLREYHRDNITTEIVESANGIATRISedtdkklalin---------- 150
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81533555  128 --------------------------------------------SIDDERYSKFEQTLNGIKQTVKSES------VESAR 157
gi 123073691 150 ---------------------------------dtidgirreyqDADRELSASYQAGIEGLKATMASDKlglqaeIKMSA 196
gi 81533719  150 ---------------------------------esingirreyqNADKKLSASYQLGIDGLKATMRSDKiglqaeIQTTA 196
gi 122152232 144 ---------------------------------etvsgirreyqDADRQLSSSYQAGIEGLKATMANDKiglqaeIQTTA 190
gi 126011112 161 eslleqktaqlgltvdglrldlnradkqtaslqasieglrqdyqDADRQLSSTYQAGIEGLKAQLTNDKlglraeIQASA 240
gi 157311179 150 ---------------------------------etikgikreyqDADRQLSASYQAGIDGLKTQLANDKiglqaeIKLSA 196
gi 489078853 151 ---------------------------------etvsgirrdyqDADRQLSSTYQAGINGLKATMANDKndlkavIQATA 197
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81533555  158 TQLASMFDSRISGLDGKYSRLSQ-TIDSLSSRLDDGVGNYSTLSQ--------KVSG-----------IDLRVSNAANDV 217
gi 123073691 197 RGLSQKYDDEIRKLSAKITTTSSgTTEAYENKLEGLRAEFTRSNQgmrielesQISGlravqqstasqISQEIRDRTGAV 276
gi 81533719  197 QGLYQRYDNEIRKLSAKITTTSSgTTEAYESKLDGLRAEFTHSNQgmrvelesKISGlqstqqatarqISQEISNREGAV 276
gi 122152232 191 QGLYQRYDNEIRKLSAKITTTSSgTTEAYESKLDGLRAEFTHSNQgmrvelesKISGlqstqqatarqISQEISNREGAV 270
gi 126011112 241 QGLSQRYDNELKQLSAKITTTSSgTTEAYENKLNDLRAEFTRSNQgmrtvlesKISGlqstqqstayqISQEIKNREGAV 320
gi 157311179 197 QGLSQKYDDELRKLYAKITTTSSgTTEAYENKLEGLRAEFTRSNQgmrtelesQISGlrsvqqstakqISQEIRDRTGAV 276
gi 489078853 198 QGLSQKYDDEIQQLSAKITTTSSgTTEAYESKLADLRAEFTRSHQgmrtvlesRISGlqstqqstayqISQEIKNREGAV 277
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81533555  218 SRLSQTAQGLQSQITNANQNYSSLSQTVQGLQTTVRDNQSNATSRINQLSDLISTKVSKGDVETTIAQSYDKIAFAI-RD 296
gi 123073691 277 SRVQQDLDSYQRRLQDAEDNYSSLTHTVRGLQSDVVSPTGKIQSRLTQLAGQIEQRVTRDGVMSIISGAGDSIKLAIqKA 356
gi 81533719  277 SRVQQGLDSYQRRLQSAEGNYNSLRETVAGYERRISNQDNTISSNFTQLKSLINQSVTLGKIQSLLRQSGDSIMLAIkDK 356
gi 122152232 271 SRVQQGLDSYQRRLQNAEGSYSSLQQTVSGLQSDVNSPNSKLNSRISQLASQIDQRVTRADVTSIINQSGDSIKLAIqRA 350
gi 126011112 321 SRVQQDLDSYQRRLQDTEKNYSSLTQTVKGLQSTVSAPNRGLESRVTQLAGLIEQKVTRGEMESYIRGAGDSIMLAI-KG 399
gi 157311179 277 SRVQQDLASYQRRLQDAEKNYSSLTQTVKGLQSTVSDPSGKIQSRFTQLQNQIDQRVTRDDVMSIINLSGDSIKLAIqKA 356
gi 489078853 278 SRVQQDLASYQRRLQDTEKNYSSLTQTVRGLQSTVSAPNRGLESRVTQLAGLIEQKVTRGEMESYIRGAGDSIMLAI-KG 356
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81533555  297 KLPASKMSGSEIISAINLDRSGVKITGKNITLDGNSYISNAVikDAHIAN---MDAGKINTGYLNANRIATEAITGEKIK 373
gi 123073691 357 GGINAKMSGNEIISAINLNSYGVTIAGKHIALDGNTTVNGTF--TTKIAEaikIRADQIIAGTIDAARIRVINLNASSIV 434
gi 81533719  357 I-PQSKMSGSDIISAINLNSRGVQIAGKNIALDGNTTVNGAF--GAKLGEfikLRADQIIGGTIDANKINVINLKASSIV 433
gi 122152232 351 GGIDAKMSAKEIVSAINLNGYGVRISGERIALDGNTTVNGAF--GAKIGEfikLKADQIIGGTIDANKINVINLNASSIV 428
gi 126011112 400 KLPQSKMSAKEIVSAINLNGYGVRISGERIALDGNTTVNGAF--GAKLGEfikLRADNIIGGTIDANKINVINLNASSIV 477
gi 157311179 357 GGIDAKMSAKEIISAINLNGYGVRISGERIALDGNTTVNGAF--GAKLGEfikLKADQIIGGTIDAAKIRVINLNASSIV 434
gi 489078853 357 KLPQSKMSASEIVSAINLNGYGVRISGERIALDGNTTVNGAF--GAKLGEfikLKADQIIGGTIDANKINVINLNASSIV 434
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81533555  374 mdyaffnKLTANegyfrtlFAKDIFATSVQSVtlsaskITGGVLAATNGASQWDLNNANmtfnrdatINFNSKNNALVRK 453
gi 123073691 435 -------GLDAN-------FIKAKIGYAITDL------LEGKVIKARNGAMTIDLQSGQ--------INHYTNESAMRRI 486
gi 81533719  434 -------GLDAN-------FIKARISYAITDL------LEGKVIKARNGAMTIDLQSGQ--------INHYTNESAMRRI 485
gi 122152232 429 -------GLDAN-------FIKARIEYAITSL------LEGKVIKARNGAMTIDLQSGQ--------INHYTNESAMRRI 480
gi 126011112 478 -------GLDAN-------FIKAKIEYAITSL------LEGKVIRARNGAMLVDLNSAKmdfnsnaeIVFNNTSNILYRQ 537
gi 157311179 435 -------GLDAN-------FIRAKIEHTITSL------LEGKVIRARNGAMMIDLSNSKidfnsnatINFNNKDNALVRK 494
gi 489078853 435 -------GLDAN-------FIKARIEHTITSL------LEGKVIRARNGAMMIDLNNSTidfnsdasINFNSNNNALVRK 494
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81533555  454 D-GTHTAFVHFSNATPK----GYRGSALYASIGITS------SGDGIDSASSGRFAGLRSFRYATGYNHTAAVdqtELYG 522
gi 123073691 487 DsSTASQFIKMTKSGFI----SEIGNMQAAMTVIGS------NSDGSENHENKTFGGIRIWNGKSSYQSTSFV---ELVG 553
gi 81533719  486 DsSTASQFIKMTKSGFI----SEIGNMQAAMTVIGS------NSDGSENHENKTFGGIRIWNGKSSYQSTSFV---ELVG 552
gi 122152232 481 DsSTASQFIKMTKSGFI----SEIGNMQAAMTVIGS------NSDGSENHENKTFGGIRIWNGKSSYQSTSFV---ELVG 547
gi 126011112 538 KmINSYRYGNRNNIGALvfkdGYEGGVQVTLGVVSDktidqvKSGAVDWNDDGGYAGIRIRRIAP----YSDAdgvEIIG 613
gi 157311179 495 D-GTHTAFVHFSNATPK----NYTSSALYASIGITS------SGDGINSASSGRFCGARFFRYARGYEHTALVdqaEIYG 563
gi 489078853 495 S-GTHTAFVHFGNATPK----NFTRSALYASIGITS------SGDGINSASSGRFCGARFFRTASGYEHTASVdqaEIYG 563
                        650       660       670       680       690
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 81533555  523 DNVLIADDFNinrgfkfrpdKMEKVLDmndlyaavvalgrcwghlanvgwntahsnFT 580
gi 123073691 554 NRVAIYGNKN----------RSPWLFD-----------------------------ST 572
gi 81533719  553 NRVAIYGNKN----------RSPWLFD-----------------------------ST 571
gi 122152232 548 NRVAIYGNKN----------RSPWLFD-----------------------------ST 566
gi 126011112 614 DRIIFRHTTKthvagtlywqNTGWLGNw---------------------------nLG 644
gi 157311179 564 DDIVFSDDFNidrgfkmrpsLMPKMVDlnkmyqai--------------lalgpllVT 607
gi 489078853 564 DTIIFADDFGinrgfkmtptGVNTLVDinkmyyaivalarcwkhlqnvgwdtthpnFT 621
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap