Conserved Protein Domain Family
Gp58

?
pfam07902: Gp58 
gp58-like protein
Sequences found in this family are derived from a number of bacteriophage and prophage proteins. They are similar to gp58, a minor structural protein of Lactococcus delbrueckii bacteriophage LL-H.
Statistics
?
PSSM-Id: 311727
View PSSM: pfam07902
Aligned: 7 rows
Threshold Bit Score: 708.645
Threshold Setting Gi: 81533555
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123073691   1 MSRDPTLTLDESNLVIGKDGRVHYTFTASQDNQTVRLASN-CLGTAHFNQLMIERGDKATGYVAPVVVEGSGESTGVFKS 79
gi 81533719    1 MSRDPTLTLDESNLVIGKDGRVHYTFTASQDNQTVRLASN-CLGTAHFNQLMIERGDKATGYVAPVVVEGSGELTGVFKS 79
gi 122152232   1 MSRDPTLLIDESNLTIGSDGRAYYTFTADGDTKSVKIANNkCIGTTRFNQLMIERGGKPTNYVAPVVVEGTGNPTGLFKD 80
gi 81533555    1 MSRDPTYTINEHDLSF-ADGRFYVTFKADKSSETVRLNSS-CLGNTIIKKLQVEDDNTMHDFVKPKVT--TQQAFGLAQQ 76
gi 126011112   1 MSRDPTLLIDESNLTIGSDGRAYYTFTADGDTKSVKIANGkCIGTTRFSQLMIERGNKPTSYVAPVVVEGSGESTGLFKN 80
gi 157311179   1 MSRDPTLTLDESNLTIGSDGRVHYTFTASQDNQKVRLASN-CLGTTRFNQVMIERGDKATDYVAPVVVEGSGESTGVFKS 79
gi 489078853   1 MSRDPTLLIDESNLTIGSDGRAYYTFKADGDTKSVKLANNkCIGTTRFNQLMIERGGKPTNYVAPVVVEGSGESTGLFKN 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123073691  80 LEEMLSGLQSINLELTDTKNSNLWSKIKLTTNGMLREYHRDNITTEIIEKADGIATRISEDSDKKL-------------- 145
gi 81533719   80 LEEMLSSLRSINLELTDTKDSKLWSKIKLTNRGMLQEYYDGKIKTEIVNSAQGVATRITEETGKKL-------------- 145
gi 122152232  81 -------LKEISLELTDTKNSKLWSKIKLNNQGMIEEYYNGTIKSEIIKTAEGTQQRISSETDKKL-------------- 139
gi 81533555   77 -------VKELDLQLKDPK-SDLWGKIKFNNKAMLVEYANKEMSSAIAQSAEQILLQVK--------------------- 127
gi 126011112  81 LEGALSQLKELNLELTDTEKSNLWAKIKLNNRGMLQTYFDTTIKNEILTTARGIKETIS-DTERGLqseflktvqgqriq 159
gi 157311179  80 LEEMLSGLQSINLELTDTKNSNLWSKIKLTTNGMLREYHRDHIKTEIVESADGIAKRIADDTGQKL-------------- 145
gi 489078853  81 LEGALSQLKELNLELTDTVNSQLWAKIKLTTNGMLREYHRDNITTEIVESANGIATRISEDTDKKL-------------- 146
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123073691 146 ------------------------------ALINDTIDGIRREYQDADRELSASYQAGIEGLKATMASDKLGLQAEIKMS 195
gi 81533719  146 ------------------------------ALINESINGIRREYQNADKKLSASYQLGIDGLKATMRSDKIGLQAEIQTT 195
gi 122152232 140 ------------------------------ALINETVSGIRREYQDADRQLSSSYQAGIEGLKATMANDKIGLQAEIQTT 189
gi 81533555  128 ---------------------------------------------SIDDERYSKFEQTLNGIKQTVKSES------VESA 156
gi 126011112 160 leslleqktaqlgltvdglrldlnradkqtASLQASIEGLRQDYQDADRQLSSTYQAGIEGLKAQLTNDKLGLRAEIQAS 239
gi 157311179 146 ------------------------------ALINETIKGIKREYQDADRQLSASYQAGIDGLKTQLANDKIGLQAEIKLS 195
gi 489078853 147 ------------------------------ALINETVSGIRRDYQDADRQLSSTYQAGINGLKATMANDKNDLKAVIQAT 196
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123073691 196 ARGLSQKYDDEIRKLSAKITTTSSGTTEAYENKLEGLRAEFTRSNQGMRIELESQISGLRAVQQSTASQISQEIRDRTGA 275
gi 81533719  196 AQGLYQRYDNEIRKLSAKITTTSSGTTEAYESKLDGLRAEFTHSNQGMRVELESKISGLQSTQQATARQISQEISNREGA 275
gi 122152232 190 AQGLYQRYDNEIRKLSAKITTTSSGTTEAYESKLDGLRAEFTHSNQGMRVELESKISGLQSTQQATARQISQEISNREGA 269
gi 81533555  157 RTQLASMFDSRISGLDGKYSRLSQ-TIDSLSSRLDDGVGNYSTLSQ--------KVSG-----------IDLRVSNAAND 216
gi 126011112 240 AQGLSQRYDNELKQLSAKITTTSSGTTEAYENKLNDLRAEFTRSNQGMRTVLESKISGLQSTQQSTAYQISQEIKNREGA 319
gi 157311179 196 AQGLSQKYDDELRKLYAKITTTSSGTTEAYENKLEGLRAEFTRSNQGMRTELESQISGLRSVQQSTAKQISQEIRDRTGA 275
gi 489078853 197 AQGLSQKYDDEIQQLSAKITTTSSGTTEAYESKLADLRAEFTRSHQGMRTVLESRISGLQSTQQSTAYQISQEIKNREGA 276
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123073691 276 VSRVQQDLDSYQRRLQDAEDNYSSLTHTVRGLQSDVVSPTGKIQSRLTQLAGQIEQRVTRDGVMSIISGAGDSIKLAIqK 355
gi 81533719  276 VSRVQQGLDSYQRRLQSAEGNYNSLRETVAGYERRISNQDNTISSNFTQLKSLINQSVTLGKIQSLLRQSGDSIMLAIkD 355
gi 122152232 270 VSRVQQGLDSYQRRLQNAEGSYSSLQQTVSGLQSDVNSPNSKLNSRISQLASQIDQRVTRADVTSIINQSGDSIKLAIqR 349
gi 81533555  217 VSRLSQTAQGLQSQITNANQNYSSLSQTVQGLQTTVRDNQSNATSRINQLSDLISTKVSKGDVETTIAQSYDKIAFAI-R 295
gi 126011112 320 VSRVQQDLDSYQRRLQDTEKNYSSLTQTVKGLQSTVSAPNRGLESRVTQLAGLIEQKVTRGEMESYIRGAGDSIMLAI-K 398
gi 157311179 276 VSRVQQDLASYQRRLQDAEKNYSSLTQTVKGLQSTVSDPSGKIQSRFTQLQNQIDQRVTRDDVMSIINLSGDSIKLAIqK 355
gi 489078853 277 VSRVQQDLASYQRRLQDTEKNYSSLTQTVRGLQSTVSAPNRGLESRVTQLAGLIEQKVTRGEMESYIRGAGDSIMLAI-K 355
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123073691 356 AGgINAKMSGNEIISAINLNSYGVTIAGKHIALDGNTTVNGTF--TTKIAEAIKIRADQIIAGTIDAARIRVINLNASSI 433
gi 81533719  356 KI-PQSKMSGSDIISAINLNSRGVQIAGKNIALDGNTTVNGAF--GAKLGEFIKLRADQIIGGTIDANKINVINLKASSI 432
gi 122152232 350 AGgIDAKMSAKEIVSAINLNGYGVRISGERIALDGNTTVNGAF--GAKIGEFIKLKADQIIGGTIDANKINVINLNASSI 427
gi 81533555  296 DKlPASKMSGSEIISAINLDRSGVKITGKNITLDGNSYISNAVikDAHIAN---MDAGKINTGYLNANRIATEAITGEKI 372
gi 126011112 399 GKlPQSKMSAKEIVSAINLNGYGVRISGERIALDGNTTVNGAF--GAKLGEFIKLRADNIIGGTIDANKINVINLNASSI 476
gi 157311179 356 AGgIDAKMSAKEIISAINLNGYGVRISGERIALDGNTTVNGAF--GAKLGEFIKLKADQIIGGTIDAAKIRVINLNASSI 433
gi 489078853 356 GKlPQSKMSASEIVSAINLNGYGVRISGERIALDGNTTVNGAF--GAKLGEFIKLKADQIIGGTIDANKINVINLNASSI 433
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123073691 434 V-------GLDAN-------FIKAKIGYAITDL------LEGKVIKARNGAMTIDLQSGQ--------INHYTNESAMRR 485
gi 81533719  433 V-------GLDAN-------FIKARISYAITDL------LEGKVIKARNGAMTIDLQSGQ--------INHYTNESAMRR 484
gi 122152232 428 V-------GLDAN-------FIKARIEYAITSL------LEGKVIKARNGAMTIDLQSGQ--------INHYTNESAMRR 479
gi 81533555  373 KmdyaffnKLTANegyfrtlFAKDIFATSVQSVtlsaskITGGVLAATNGASQWDLNNANmtfnrdatINFNSKNNALVR 452
gi 126011112 477 V-------GLDAN-------FIKAKIEYAITSL------LEGKVIRARNGAMLVDLNSAKmdfnsnaeIVFNNTSNILYR 536
gi 157311179 434 V-------GLDAN-------FIRAKIEHTITSL------LEGKVIRARNGAMMIDLSNSKidfnsnatINFNNKDNALVR 493
gi 489078853 434 V-------GLDAN-------FIKARIEHTITSL------LEGKVIRARNGAMMIDLNNSTidfnsdasINFNSNNNALVR 493
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123073691 486 IDsSTASQFIKMTKSGFI----SEIGNMQAAMTVIGS------NSDGSENHENKTFGGIRIWNGKSSYQSTSFV---ELV 552
gi 81533719  485 IDsSTASQFIKMTKSGFI----SEIGNMQAAMTVIGS------NSDGSENHENKTFGGIRIWNGKSSYQSTSFV---ELV 551
gi 122152232 480 IDsSTASQFIKMTKSGFI----SEIGNMQAAMTVIGS------NSDGSENHENKTFGGIRIWNGKSSYQSTSFV---ELV 546
gi 81533555  453 KD-GTHTAFVHFSNATPK----GYRGSALYASIGITS------SGDGIDSASSGRFAGLRSFRYATGYNHTAAVdqtELY 521
gi 126011112 537 QKmINSYRYGNRNNIGALvfkdGYEGGVQVTLGVVSDktidqvKSGAVDWNDDGGYAGIRIRRIAP----YSDAdgvEII 612
gi 157311179 494 KD-GTHTAFVHFSNATPK----NYTSSALYASIGITS------SGDGINSASSGRFCGARFFRYARGYEHTALVdqaEIY 562
gi 489078853 494 KS-GTHTAFVHFGNATPK----NFTRSALYASIGITS------SGDGINSASSGRFCGARFFRTASGYEHTASVdqaEIY 562
                        650       660       670       680       690
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 123073691 553 GNRVAIYGNKN----------RSPWLFD-----------------------------ST 572
gi 81533719  552 GNRVAIYGNKN----------RSPWLFD-----------------------------ST 571
gi 122152232 547 GNRVAIYGNKN----------RSPWLFD-----------------------------ST 566
gi 81533555  522 GDNVLIADDFNinrgfkfrpdKMEKVLDmndlyaavvalgrcwghlanvgwntahsnFT 580
gi 126011112 613 GDRIIFRHTTKthvagtlywqNTGWLGNw---------------------------nLG 644
gi 157311179 563 GDDIVFSDDFNidrgfkmrpsLMPKMVDlnkmyqai--------------lalgpllVT 607
gi 489078853 563 GDTIIFADDFGinrgfkmtptGVNTLVDinkmyyaivalarcwkhlqnvgwdtthpnFT 621
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap