Conserved Protein Domain Family
YibE_F

?
pfam07907: YibE_F 
YibE/F-like protein
The sequences featured in this family are similar to two proteins expressed by Lactococcus lactis, YibE and YibF. Most of the members of this family are annotated as being putative membrane proteins, and in fact the sequences contain a high proportion of hydrophobic residues.
Statistics
?
PSSM-Id: 336860
View PSSM: pfam07907
Aligned: 322 rows
Threshold Bit Score: 100.905
Threshold Setting Gi: 122276038
Created: 26-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81411693  148 VYALIFIFAAVLIFVGKKNGLKALISLGLTIGLIFGIFLPLIlQGHNPILWAIIICSLASVITLFIISGMNNKTYTAILG 227
gi 503883416   2 TMVLMLMLLATLLFVGRAQSEKIVVTLLLNGVILLCAMVLML-MGFHAVFVGWLCILGTSILTLFYQNGFNQKTAAAFLA 80
gi 503743330   3 ILILTVVLFVLLVAIGDERGVASMFTILGNMLLMLLCFYLIA-HGKNPYLVTAVCVLLFLLLTLFAQNGANPKTAASFLS 81
gi 524752653   2 aVILGTILIILMIVIGEERGVAGVFVLAGNMILLWMCIKFIA-DGSSVFLVLFIGSMIFTGLTLFAQNGCNRKIVSAFLS 80
gi 490750075   2 IGVLALVLFLLLILIGGDRGAVAVLALCGNIAVLAFTVILLA-NGAPPFLVIFAATLSISYITLLKQNGNNLKTRSALLS 80
gi 524466027   2 tGILVLILFLLMVAVGGERGAIAVLVLCGNILVLGGTIILLA-KGYPVFPVVFLAAVIISYISLMKQNGKNVKTFAAFAA 80
gi 651890047   2 IIFLALVLIILMILIGGERGAVSLMTLAGNIVILFISILLMS-IGFPALLLILAAGAGVCYNSLFYQNGNNPKTRAAFLA 80
gi 524712936   1 -MILGFILLFLIMIIGGDRGVISLISLVGNMLLLSLAIWLMA-AGAPVLLVTVGVGIIISCVTLFYQNGTNEKTKSAFTA 78
gi 491478791   2 LIILGLILISLIVIVGGDRGVVSLIALVGNLLLLSFAIWLMA-TGVPVLFVTVGAGIMISCITLFYQNGTNVKTWSAFIS 80
gi 291551115   2 LITLGLILLILIMVVGGDRGVVSLIALCGNLLILSLAIWLMA-SGVPVLLVTVCVGVVISCITLFYQNGRNGKTWSAFLA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81411693  228 TIGGVIIAGLFAFVAGKILRLSGLGNEDAQMLAF-VP-Qy-rKIDYQGLLFAGIMIGSLGAVMDVAMSISSSMWEIVAVS 304
gi 503883416  81 LLIVVVLMSFLIWFVCVRAGLYGLDERNWEEDDV-VMlDlhlHINMIRVTYVVIALGLLGAAKDSAMAVATGAYEVFRCH 159
gi 503743330  82 VLIVLCAVTGFSAWVIYAGSLGGFGELYIYDEEI-SFlNseiGISANALLICSILLGVLGALTDTALAVSSALYEVHANN 160
gi 524752653  81 VIIVIAVLIIFCGYSIYRTRLGGYNEFDMYGDEA-SFlNnkiHVSSFQIMTVVVLLGLLGAIIDAALSVSSAVFQIYASN 159
gi 490750075  81 VALIMFALSICIYLGVWKTGSGGLNEIQMIQEDVqLYyTmdiDIHMQQIAAGIVILSALGAVMDTALSVTSAVYEVSVHK 160
gi 524466027  81 VTGIMLVLSILIYLLVWKAQGGGLNEIQSMQEDImYFyEsdiHISMLQIAVSVTILSALGAAIDTALSVTSAVYEVKQHR 160
gi 651890047  81 TLLVMLLLFIPIYLIIWRSGSYGLNELQLSEDDFmYYyStdiHINMLHVAVFVTVFSTLGAVIDTALSVTSSVYEVWTHK 160
gi 524712936  79 VLITMAVLFFFIYMVVWRSEAGGLNEIQAAEDDV-LYyNmnlDINMRNVATAVIILSTLGAVLDMALTVTTSVYEVSIHK 157
gi 491478791  81 VAITMLVLFFVIYVVIWSTEAGGLNEIQSVGDDI-LYyNmdlNISMRNVMVSVILLSTLGAILDMALTVTTSVYEVKNHK 159
gi 291551115  81 TMITMLLLFFFIYIVVWRSEAGGLNEIQQVGEDV-FYyNmnlNISMRNVAVSVILLSTLGAVLDMALTVTTSVYEVKSHK 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81411693  305 PKIPNKQLIKSGMNIGRDIIGSMSNTLILAYVSTSIPVLLLFIIFSHGFTEIINLEILSAEILRAVSGSIGLICTIPITV 384
gi 503883416 160 PEMSWQEVYHSGMNIGRDILGVTINTLLFAVIGQSLLMIQMYFDCGYPFSQLINSKSLFQSAMVVLTGGIGVELSIPVTA 239
gi 503743330 161 PSLGFRELYRSGSRVGRDILGTTINTLLFAEFGESFFIWMIFLRQGYTLPQLLNSRSLLQEVLLIFAANIGCLLIIPLTA 240
gi 524752653 160 PSLTEKELRKSGNNIGRDILGTTVNTLFFAGIGESLLLFMMCQYYRYDMSALLNSKAFIQQLFVMIIANLGCICILPVSA 239
gi 490750075 161 SGLDRREYFHSGLQVGKDIIGTTVNTLLFAYFGESMMMFAYLQQGKYNLEMVLNSKFLFQGLAMMFVGVIACLLAVPISA 240
gi 524466027 161 PELCQKELFASGMQVGKEIIGTTVNTLLFVYLGDSMLLFAYLKKGGYTIETIVNSRFLFQELSVMLFGAVACVLIVPFAA 240
gi 651890047 161 NSLTAKELTSSGYQVGKEIIGTTVNTLLFAYLGGSILLFAYVQTQQYNLEIILNSKFLFQDVAIMLSGAIACLFTVPVSI 240
gi 524712936 158 PEIKLTELVESGMQIGREVIGTTVNTLLFAYLGESLLLFSYLKMQDYTLETLLNSKILFQNCVSMIFGAIACVVVMPVAA 237
gi 491478791 160 SEMKFTELVESGMKIGREVIGTTVNTLLFAYLGESLLLFTYLKMQNYSLELLLNSKILFQNFASMIFGAIACVMVMPIAA 239
gi 291551115 160 EDMTFKELIHSGMQIGKEVTGTTVNTLLFAYLGESLLLFSYLRMQGYSFELLLNSKIMFENCASMIFGAIACVVVMPVAA 239

                 ....*
gi 81411693  385 NLVNI 389
gi 503883416 240 LVLSa 244
gi 503743330 241 AVTAg 245
gi 524752653 240 RVSAW 244
gi 490750075 241 WTVSq 245
gi 524466027 241 YCVAY 245
gi 651890047 241 RCvir 245
gi 524712936 238 VLVgk 242
gi 491478791 240 VLMAK 244
gi 291551115 240 VAGgy 244
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap