Conserved Protein Domain Family
YibE_F

?
pfam07907: YibE_F 
YibE/F-like protein
The sequences featured in this family are similar to two proteins expressed by Lactococcus lactis, YibE and YibF. Most of the members of this family are annotated as being putative membrane proteins, and in fact the sequences contain a high proportion of hydrophobic residues.
Statistics
?
PSSM-Id: 311730
View PSSM: pfam07907
Aligned: 323 rows
Threshold Bit Score: 100.526
Threshold Setting Gi: 122276038
Created: 23-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81411693  148 VYALIFIFAAVLIFVGKKNGLKALISLGLTIGLIFGIFLPLILQGHNPILWAIIICSLASVITLFIISGMNNKTYTAILG 227
gi 524266781   4 VYILFFILFVLMLVLGGERGAKSFITLVCNVFIGAISIFLLLI-GVSPYLIIIVSSLVFCLVTIKFQNGLNIKTVSSLIS 82
gi 938973741   2 litlglillilimVVGGDRGVVSLIALCGNLLILSLAIWLMA-SGVPVLLVTVCVGVVISCITLFYQNGRNGKTWSAFLA 80
gi 503743330   3 ililtvvlfvllvAIGDERGVASMFTILGNMLLMLLCFYLIA-HGKNPYLVTAVCVLLFLLLTLFAQNGANPKTAASFLS 81
gi 491478791   2 liilglilisliviVGGDRGVVSLIALVGNLLLLSFAIWLMA-TGVPVLFVTVGAGIMISCITLFYQNGTNVKTWSAFIS 80
gi 524841463   2 ILILGAVFVILFVLLGGDRGLRSLGALLINVAVFLLDIKALE-HGFPAYLVTLITVSLMSVTILFVQNGYNLKTRATLVS 80
gi 503883416   2 TMVLMLMLLATLLFVGRAQSEKIVVTLLLNGVILLCAMVLML-MGFHAVFVGWLCILGTSILTLFYQNGFNQKTAAAFLA 80
gi 524752653   2 aVILGTILIILMIVIGEERGVAGVFVLAGNMILLWMCIKFIA-DGSSVFLVLFIGSMIFTGLTLFAQNGCNRKIVSAFLS 80
gi 651890047   2 IIFLALVLIILMILIGGERGAVSLMTLAGNIVILFISILLMS-IGFPALLLILAAGAGVCYNSLFYQNGNNPKTRAAFLA 80
gi 524712936   1 -MILGFILLFLIMIIGGDRGVISLISLVGNMLLLSLAIWLMA-AGAPVLLVTVGVGIIISCVTLFYQNGTNEKTKSAFTA 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81411693  228 TIGGVIIAGLFAFVAGKILRLSGLG----NEDAQ----MLAF-VP----Qy-rK----IDYQGLLFAGIMIGSLGAVMDV 289
gi 524266781  83 VLMVCIFSCVIIYIFSIKGHIGGFN----EIEMQ----EEEV-FF----L---GsaveFKMVNILMVAFVWGQLGAVIDT 146
gi 938973741  81 TMITMLLLFFFIYIVVWRSEAGGLN----EIQQVgedvFYYN-MN----L---N----ISMRNVAVSVILLSTLGAVLDM 144
gi 503743330  82 VLIVLCAVTGFSAWVIYAGSLGGFGelyiYDEEI----SFLN-SE----I---G----ISANALLICSILLGVLGALTDT 145
gi 491478791  81 VAITMLVLFFVIYVVIWSTEAGGLN----EIQSV----GDDI-LYynmdL---N----ISMRNVMVSVILLSTLGAILDM 144
gi 524841463  81 LAVVTVFIFFLALLVAHGAKSSGYN----ELNMY----EDET-AMl---AghvS----INMTAAAVAMVIVGIVGAVIDV 144
gi 503883416  81 LLIVVVLMSFLIWFVCVRAGLYGLD----ERNWE----EDDV-VMl---DlhlH----INMIRVTYVVIALGLLGAAKDS 144
gi 524752653  81 VIIVIAVLIIFCGYSIYRTRLGGYN----EFDMY----GDEA-SFl---NnkiH----VSSFQIMTVVVLLGLLGAIIDA 144
gi 651890047  81 TLLVMLLLFIPIYLIIWRSGSYGLN----ELQLS----EDDFmYYy---StdiH----INMLHVAVFVTVFSTLGAVIDT 145
gi 524712936  79 VLITMAVLFFFIYMVVWRSEAGGLN----EIQAA----EDDV-LYy---NmnlD----INMRNVATAVIILSTLGAVLDM 142
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81411693  290 AMSISSSMWEIVAVSPKIPNKQLIKSGMNIGRDIIGSMSNTLILAYVSTSIPVLLLFIIFSHGFTEIINLEILSAEILRA 369
gi 524266781 147 SMAISSSLHEIFIHNPDYSKRKLIYEGAVIGKDILGTTVNTLSFVFLGESLMLFIYYRTYVYSTNTIINSSSFFQEIFSL 226
gi 938973741 145 ALTVTTSVYEVKSHKEDMTFKELIHSGMQIGKEVTGTTVNTLLFAYLGESLLLFSYLRMQGYSFELLLNSKIMFENCASM 224
gi 503743330 146 ALAVSSALYEVHANNPSLGFRELYRSGSRVGRDILGTTINTLLFAEFGESFFIWMIFLRQGYTLPQLLNSRSLLQEVLLI 225
gi 491478791 145 ALTVTTSVYEVKNHKSEMKFTELVESGMKIGREVIGTTVNTLLFAYLGESLLLFTYLKMQNYSLELLLNSKILFQNFASM 224
gi 524841463 145 AIAVSSAVYEVKCKNPELTERELLASGFRMGGNILGTTVNTLLFAGLGESLLMYLEMKELHYTFGQLLNSKAFFQMLFPV 224
gi 503883416 145 AMAVATGAYEVFRCHPEMSWQEVYHSGMNIGRDILGVTINTLLFAVIGQSLLMIQMYFDCGYPFSQLINSKSLFQSAMVV 224
gi 524752653 145 ALSVSSAVFQIYASNPSLTEKELRKSGNNIGRDILGTTVNTLFFAGIGESLLLFMMCQYYRYDMSALLNSKAFIQQLFVM 224
gi 651890047 146 ALSVTSSVYEVWTHKNSLTAKELTSSGYQVGKEIIGTTVNTLLFAYLGGSILLFAYVQTQQYNLEIILNSKFLFQDVAIM 225
gi 524712936 143 ALTVTTSVYEVSIHKPEIKLTELVESGMQIGREVIGTTVNTLLFAYLGESLLLFSYLKMQDYTLETLLNSKILFQNCVSM 222
                        250       260
                 ....*....|....*....|
gi 81411693  370 VSGSIGLICTIPITVNLVNI 389
gi 524266781 227 LLSCIGCLIIIPLTSFIYAI 246
gi 938973741 225 IFGAIacvvvmpvaavagga 244
gi 503743330 226 FAANIGCLLIIPLTAAVTAg 245
gi 491478791 225 IFGAIACVMVMPIAAVLMAk 244
gi 524841463 225 MMSAIGCVCIVPVAAWIMGn 244
gi 503883416 225 LTGGIGVELSIPVTALVLSa 244
gi 524752653 225 IIANLGCICILPVSARVSAW 244
gi 651890047 226 LSGAIACLFTVPVSIRCvir 245
gi 524712936 223 IFGAIACVVVMPVAAVLVgk 242
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap