Conserved Protein Domain Family
DUF1679

?
pfam07914: DUF1679 
Protein of unknown function (DUF1679)
The region featured in this family is found in a number of C. elegans proteins, in one case as a repeat. In many of the family members, this region is associated with the CHK region described by SMART as being found in ZnF_C4 and HLH domain-containing kinases. In fact, one member of this family is annotated as being a member of the nuclear hormone receptor family, and contains regions typical of such proteins (Interpro:IPR000536, Interpro:IPR008946, and Interpro:IPR001628).
Statistics
?
PSSM-Id: 311733
View PSSM: pfam07914
Aligned: 20 rows
Threshold Bit Score: 462.135
Threshold Setting Gi: 74964700
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75025680   10 ILDNGDGLFQTHVQLDDVQDVIGEQMNTEARLGKNTKYTVVGDGNGFMSRVILVEPEWT--VPDEHLPEKFILKITSCLH 87
gi 75028419    8 ILDNGEGLFQTHVYVKDVQEAIGEQMNTESRLGENTKYTVVGDGNGFMSRVVLVEPEWT--ITENHLPKKFILKICSSLH 85
gi 75028423    7 LIQNGDGLFQTHVQLEDVQELIRDQMNTEARLGEKTKYTVVGDGNGFMSRVILVEPEWT--ITDENLPKKFILKITSCLH 84
gi 75028424    8 IIDNGDGLFETHVKLEDIQILIKEQMNTDSKLGEKTKLTVVGDGNGFMSRVVLVEADWT--IPNENLPEKIILKLTSCIN 85
gi 74959989    8 ILQPGTGLFNTHVTLEDVNKAIKEQMSTESELTAESKMEVIGEGNGFSSCVILITCHWT--IPSSHLPKKLILKIVSFVH 85
gi 75015554    8 ILQPGTGLFNTHVTLFDVNKAIKEQMSTESELTAESKMEVIGDGNGFSSRVLLISCNWT--IPSAHLPKKLILKIVSFVH 85
gi 74965004    3 LYTVADGLLGTHVTWEDVLEEMQKALDTTATFGDDKTATNISDMKGFMSKIALVEPKWVgaSENEELPEKFVVKISSQLP 82
gi 268556318  35 ILEDGNGLFSTHVALDDVNFAIKNEMRTESELSKDSLLEIIGDGNGFSSCVILVTCDWS--IPSIDLPKKLVLKIVSFTH 112
gi 268566515   9 ILEDGNGLFGTHVTLKDVNDAIREQMDTDLELTPKSKMTVIGDGNGFSSCVILISCKWN--KPSDTLPHKIVLKVVSFSH 86
gi 268556822   3 LYTAADGLLGTHVTWGEVEEQMQKALDTSAKFGDDKTVTNISDMKGFMSRIALVEPHWVgaSDDEELPEKFIVKISSQLP 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75025680   88 VHGLVEKMKgkspGAF---PAEQEaalWAIFENEAQQLHNREVNLYKITEKWnkNETMLSPKIYFYKKFDAENKTKGILG 164
gi 75028419   86 VHGIVDKMKesnqSI-----NENEeelWAMFENEAQHLHNREVNFYVLAEKWnkPEELLNAKIFFSKKFDSENKLKGFLG 160
gi 75028423   85 VVGLLEKLKeseqNVI---NDANEadlMALFENESRLFHNREVNLYKITKKWnkNDELLSPKIYFYKKFDSENQTKGILG 161
gi 75028424   86 VHHLVSQMKeknpDAF---TEQQEaelWAMFEREAQNVHNREVNLYRITEKWnkNDALLSPKIYFYKKFDCENKTQGVLG 162
gi 74959989   86 VQGLLNKSNeegnSVM---SPEEEahvHAHFEKSCQKGHNLEVEFCEAFGHLe---GLLLPKVFFSQKFEEDNPNKGFVG 159
gi 75015554   86 IQALIDKGKqqnaSLI---TKEVEeqmYAYFESSCKKMHNQEMNFYEVAGKFn-SKTLLIPKVYFYTKLDEKNSNKGFIG 161
gi 74965004   83 FIEMTKLMDfssgDEF---WDDAK---LKGMGEVTRLLHNREVATYKILMREk-HPKIPFTKVYASKPFDDENKLKAYLI 155
gi 268556318 113 IKRLIDNAKskgfCKVkskDEEKM---AEHFLISILAMHNQEINFYEILSSAn-AENILTPKVYFSQKFDETNRCKGFIG 188
gi 268566515  87 IKALISKAEkegiFKK---SENEKkdmNANFEISIQRIHNQEVDFYNVLKKGe-PENLLILKVYFTSKFDENNKTKGFIG 162
gi 268556822  83 FIEMTKLMDfn-aEEF---WDDAK---LKGMGDMTRMLHNREVSTYKILMREk-HPRIPFTKIYALKPFDDENTLKAYII 154
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75025680  165 MEFVSDVTIRHLYCNAKPYELHPVLRSLATLQAGSLHLT---EDEI-NSIsgf-dfKQMMGAMMNEegMKNIYEQTREIN 239
gi 75028419  161 MEYVDDVTIRHLYCNLKPYELHPVLKAVAQLQAESLHLS---DEEL-QSIsgf-dfKQMMGTMFNDdgLKGNYKQTRDIN 235
gi 75028423  162 MEAVDDVTVRHLYYNVKPFELHSVLKSIARLQAESLHLT---DQEK-QSIagf-dlKKMSNTIFSEegMQNNFKQTREIN 236
gi 75028424  163 MEYVDDAVVRHLYCNAKPHELHPILQSLATLQAGSLHLT---EDEI-NSIsgy-dfKSMVGRMMSEegMKQMYTRARQIN 237
gi 74959989  160 MEFVEGSVVRHCYENVTVDELQPILKALARLQALSLS-----TESC-RNLdngeafEESLMDMLSEdgLKGIFDQSRNID 233
gi 75015554  162 MEYVEGSIVRHSYDTCTIEEIQPILRAIAKLQALSLQNPaeiSKDL-QKIdngaifQETLKMMLSEsgIKGIFEQCRNLE 240
gi 74965004  156 SEYYPNIHHIGMHESIPAEDLIPVIHAIAAFSAIGMKLS---EEET-KYArgadflDIVFGQFMDEksIERMNVLLKASF 231
gi 268556318 189 MEFLEGIGIRHSYENCTVQEFQPILKLIASIQALSFSVP---NEDF-KRIedesvyAKSVEAMMSGegMKGCFEHTRLRD 264
gi 268566515 163 MEYIEGSETRHSYENCTVKEIQPVLKAIAHIQALTVSTP---EEEIeKTFndssytE-SMKSMMEGdrMTGIFMHTKNQN 238
gi 268556822 155 SEYIPDLHHIGMHESISAEDLLPIVHAIAAFSAFGMKLS---EEET-KYAqgadflDIVFGQFMDEktITKSEDMMRAAF 230
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75025680  240 ----PERLTEKTNTVEAFGLEVVNFELSCNLNKYVGIeRDVLVHGDLWAANILWKEENDgkfsVSKVIDYQLIHMGNPAE 315
gi 75028419  236 ----PERLKEKTDIVEAFGMEVVNFEFAGNLNKVVGIhKDVLVHGDLWAANILWNE-NDgkfsASKVIDYQIIHMGNPAE 310
gi 75028423  237 ----PERLKESVDKVEIYGTELVDLDKAINLNSYIGIeRDVLVHGDLWSANILWEE-NEgkflVSKVIDYQLIHMGNPAE 311
gi 75028424  238 ----PERLTKPTDAVEALGMDIVNFEISCHVNKYAGIqKNVLVHGDLWAANILWKE-NDgncvASKVIDYQLIHMGNPAE 312
gi 74959989  234 -----QKLSEKVERIEQNHKEILNLETVLNLNKVVGIdQKVICHGDLWAANILWTQ-TDggfiADKVLDYQESHMGNPAE 307
gi 75015554  241 ----RSRFGEKVDRIEEKRNEILDFEKAFNLNKVVGIkQNVLCHGDLWAANFLWTE-NNgvfcATRIVDYQMSHLGNPAE 315
gi 74965004  232 peeyLEKVEEMLKIYKDYYFQPQMIKNFKNTCQFFGY-KPVLTHSDLWSSNFLCTRDGEkv-tLKAIIDFQTVSITTPAQ 309
gi 268556318 265 ----TEQFTDIVERIQGYGTKILDFKKAFNLNKVLGYyQKRLRSRGPLEANILWTKESNgqftALKVIDYQTAHTGNPAE 340
gi 268566515 239 ----PERFGELVASVERLAPGILDFEKACNLNKYIGInKNVFVHGDLWSANILFAPGKDasmyVSKVLDYQLAHMGNPAE 314
gi 268556822 231 sadySEKVEKMLKINRDYYLNPKMLSNFKKTCDFFGY-KPVLTHSDLWSSNFLCSRDGEkv-tLRAIIDYQTVTVTTPAQ 308
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75025680  316 DLVRVFLSTLSGADRQAHWERLLEQFYEYFLEALGDD-KPPYSLEQLKESYRCYFVSGGLVMMPMYGPIAQV--KlsySN 392
gi 75028419  311 DLVRVFLCTLSGADRQAHWEKLLEQFYEYFLEALEDN-EIPYTLDQLKESYRLYFVTGSLVMLPLYGPIAQT--KlsySK 387
gi 75028423  312 DLVRLLLCTLSGADRQAHWERLLEQFYEYFLEALQDN-ETPYSLEQLKESYRQYFVTAGLFMLPMFGPIAQM--KlsySS 388
gi 75028424  313 DLVRVFLSTLSGADRQAHWEKLLEQFYEYFLEALEGN-EAPYTLDQLKESYRLYFVGGGLFVMPLFGPVAQA--KlsyST 389
gi 74959989  308 DLVRLLVSTISGADRQSHWEHILEQFYTYFTDEIGSN-NAPYTLEQLKTSFKLYFPVGALTLISLFGPAVDM--Kl-qGM 383
gi 75015554  316 DLVRLLVSTITGADRQAHWQQILEQFYSYFLNELGSG-EAPYTLEQLKLSFKLYFPVGALALLPLFGPAVDA--Kl-eGM 391
gi 74965004  310 DVGRLFASCLSTKDRREKADFLLEEYYNTFVNEL-DGmDVPYTFQQLKDSYQVYFPLMTTMVLPGIAPMLQH--S---NV 383
gi 268556318 341 DLVRFLTSTLSGSDRQAHWEQILETFYEYFLEALGEN-KAPYSSEELKKSYKLFFPMGGLALLPLFGAAVDM--Kl-eSM 416
gi 268566515 315 DLVRFLCSTLSGSERRQNWERLLEDFYAYFLEAMQTR-EIPYTLEQLKLSYRSYFPMGGLALLPLLGPAVDVkiK---SM 390
gi 268556822 309 DVGRLFASCLSTKDRREKVDFLLEEYYKTFVKEL-DGmEVPYTLQNLKDSYQVYFPLMSSMVLPGIAPLLEH--A---HV 382
                        410       420       430
                 ....*....|....*....|....*....|.
gi 75025680  393 DTESVEEYREILTEKAEHLMEDLERWHLYSK 423
gi 75028419  388 DTEHVEEYREILTEKAEKLLEDMEHWHFYSR 418
gi 75028423  389 DNEHAEEYREVLTEKAERLMEDLERWHLHSK 419
gi 75028424  390 DNENVEEYREVLTEKAERLMEDLKRWHLYSK 420
gi 74959989  384 ESGKAENYRRIVIEKVDCLLDDVLNFHDFNK 414
gi 75015554  392 DSEKAEKCRHVVIEKVACLLDDLEKYHKFSK 422
gi 74965004  384 TEEYKDSMKQVALDKMIGLLEDVITTHESNI 414
gi 268556318 417 DKDETEKYKNIVIEKLKCLLEDVEKFYLESs 447
gi 268566515 391 SEQTAEKYQKVLAEKIECLLEDVEKFYLETI 421
gi 268556822 383 SEEYREAMKEVAMAKMVGLLEDVISTHESSI 413
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap