Conserved Protein Domain Family
Vps54

?
pfam07928: Vps54 
Vps54-like protein
This family contains various proteins that are homologs of the yeast Vps54 protein, such as the rat homolog, the human homolog, and the mouse homolog. In yeast, Vps54 associates with Vps52 and Vps53 proteins to form a trimolecular complex that is involved in protein transport between Golgi, endosomal, and vacuolar compartments. All Vps54 homologs contain a coiled coil region (not found in the region featured in this family) and multiple dileucine motifs.
Statistics
?
PSSM-Id: 311744
View PSSM: pfam07928
Aligned: 117 rows
Threshold Bit Score: 79.8576
Threshold Setting Gi: 915015117
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74635353   636 ASFIIPNGTTHLVDGLVGFLQLVVIFP-GQTPELVDVITSLIKRYNVSANELILQAGATRsAAKLAH--ISAKNLALVSQ 712
gi 124453716 2109 SKYKVTQAFLFFLQAISQYLHLFESYS-VINYEQTQKLVELIKCYNSLATQYILGAGAVH-FGKIST--ITAKNLAISSI 2184
gi 121979694  773 QTYKLTSAFLQILKMIYEYLHLIDYFK-SMRETSSKKLIELLKFYNSYANELLIGGGAFQ--LGVQ---VSAVNLALSSV 846
gi 122123833  828 dgRVVSVSLQILLEMLHDYDGYLGRFP-FLAFDIMGKVYDLLRLYNSQCAALLLGAMAVE-TGTLES--ITVPHMAVASQ 903
gi 891592491  701 QSIHMVNASVRLLETMNQYGQLVYHFP-RLSHYLYYGMIDLLRTLNSRVYQLILGAGTVR-SSGLSR--VLGKHIALASQ 776
gi 213408631  732 DTFSCVATSSKLLHVLVDYARFASQVP-RFSSDCYASVLELYRVVNSRVYQLIMGAGAVR-SAGLPR--VLGKHIALAAQ 807
gi 294945031  138 gSFLVVPAGLGILELIAVYLDVARALP-QLATDAAVRLTSMLRLANGQIEKLLLEGQAVS-SGSRKT--VTATNLALTYQ 213
gi 118359846  816 KKYMFSEGFLVFLKQVQKYIGIMAESKiQYSKEYFIRFISLLRQYNTFSREFIVLAKGKNpQFPQMNgkVTVKNLATSSL 895
gi 449704240  573 ETYFMTNTMSILLPTLERYREIIIKFP-LLGECALSSAKDMLILYNNSMRRLILGKELIQ-KGVVQR--IGATMFTTTHQ 648
gi 407849585  809 EGRVVSSSILMLITLLHEFDEYLSRFP-FLAFDVMGKIYDLLRLYDSQCAALLLGAMAVE-NGVLDT--ITTQHMAVASQ 884
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 74635353   713 SLGFIVTLIPYMREYCRRHv--------TSQQIpa-qFDRTKRDLLKHQDDIHTKLVSIMVER 766
gi 124453716 2185 CLRLFLYLLDPLSNKLFKVinqqqqtefTNLQQiqndFATIKVDYENHNAEVMAKLTTIVQDR 2247
gi 121979694  847 CLQFALKIFPQMTERIIGLyke----drDLAENiedqFSRLSDEYNNHNINIQKTISDILikl 905
gi 122123833  904 NLALLYDGIPLMQRRWERVvd-----gdNLPSSisedLERVRQGCQMCRLELLGKIAALVKEK 961
gi 891592491  777 TVTLFQALSTSMVKFLSKYsg------iRQtq----eLLSLENDFDLHHDQITEKFIALMKER 829
gi 213408631  808 MIRFLQSSLKIMVQFLETt---------GGINPgl-eVEKLNRDFSFHLQQVQNKFVALMREK 860
gi 294945031  214 TIDMLSSVLPLIANTLESIagkl-esgpGIRIVledlLYRLKAEMSEHKGNLTRKLGDILVER 275
gi 118359846  896 NLTFLIKIFDKIKERLVQNtd------vSKEIIda-eFQKIKIDIQNHISEIFGTIPNIIKDm 951
gi 449704240  649 TLLLLSLITPYLHHYLSPNvi------iSGRIL-----DGIEDLMKAQCTDIRNALTIIVRNR 700
gi 407849585  885 NLAFLYDGIPLMQRRWLRAtt-----vdKLASPivedIRRVRKDYATHRCEFLGKISGLVKEK 942
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap