Conserved Protein Domain Family
Toxin_trans

?
pfam07952: Toxin_trans 
Click on image for an interactive view with Cn3D
Clostridium neurotoxin, Translocation domain
The Clostridium neurotoxin family is composed of tetanus neurotoxin and seven serotypes of botulinum neurotoxin. The structure of the botulinum neurotoxin reveals a four domain protein. The N-terminal catalytic domain (pfam01742), the central translocation domains and two receptor binding domains. Subsequent to cell surface binding and receptor mediated endocytosis of the neurotoxin, an acid induced conformational change in the neurotoxin translocation domain is believed to allow the domain to penetrate the endosome and from a pore, thereby facilitating the passage of the catalytic domain across the membrane into the cytosol. The structure of the translocation reveals a pair of helices that are 105 Angstroms long and is structurally distinct from other pore forming toxins.
Statistics
?
PSSM-Id: 311759
View PSSM: pfam07952
Aligned: 5 rows
Threshold Bit Score: 489.391
Threshold Setting Gi: 135624
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3ZUR_A        631 TMFHYLRAQEFEHGKSRIALTNSVNEALLNPSRVYTFFSSdYVKKVNKATEAAMFLGWVEQLVYDFTDETSEVSTTDKIA 710
gi 160380522  549 TMFHYLRAQEFEHGKSRIALTNSVNEALLNPSRVYTFFSSdYVKKVNKATEAAMFLGWVEQLVYDFTDETSEVSTTDKIA 628
gi 501399535  536 TIFQYLYSQTFPLNIRDISLTSSFDDALLVSSKVYSFFSMdYIKTANKVVEAGLFAGWVKQIVDDFVIEANKSSTMDKIA 615
gi 135624     559 TIYQYLYAQKSPTTLQRITMTNSVDDALINSTKIYSYFPS-VISKVNQGAQGILFLQWVRDIIDDFTNESSQKTTIDKIS 637
3ZUQ_A        571 TIFQYLYSQTFPLDIRDISLTSSFDDALLFSNKVYSFFSMdYIKTANKVVEAGLFAGWVKQIVNDFVIEANKSNTMDKIA 650
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3ZUR_A        711 DITIIIPYIGPALNIGNMLYKDDFVGALIFSGAVILLEFIPEIAIPVLGTFALVSYIANKVLTVQTIDNALSKRNEKWDE 790
gi 160380522  629 DITIIIPYIGPALNIGNMLYKDDFVGALIFSGAVILLEFIPEIAIPVLGTFALVSYIANKVLTVQTIDNALSKRNEKWDE 708
gi 501399535  616 DISLIVPYIGLALNVGDETAKGNFESAFEIAGSSILLEFIPELLIPVVGVFLLESYIDNKNKIIKTIDNALTKRVEKWID 695
gi 135624     638 DVSTIVPYIGPALNIVKQGYEGNFIGALETTGVVLLLEYIPEITLPVIAALSIAESSTQKEKIIKTIDNFLEKRYEKWIE 717
3ZUQ_A        651 DISLIVPYIGLALNVGNETAKGNFENAFEIAGASILLEFIPELLIPVVGAFLLESYIDNKNKIIKTIDNALTKRNEKWSD 730
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3ZUR_A        791 VYKYIVTNWLAKVNTQIDLIRKKMKEALENQAEATKAIINYQYNQYTEEEKNNINFNIDDLSSKLNESINKAMININKFL 870
gi 160380522  709 VYKYIVTNWLAKVNTQIDLIRKKMKEALENQAEATKAIINYQYNQYTEEEKNNINFNIDDLSSKLNESINKAMININKFL 788
gi 501399535  696 MYGLIVAQWLSTVNTQFYTIKEGMYKALNYQAQALEEIIKYKYNIYSEEEKSNININFNDINSKLNDGINQAMDNINDFI 775
gi 135624     718 VYKLVKAKWLGTVNTQFQKRSYQMYRSLEYQVDAIKKIIDYEYKIYSGPDKEQIADEINNLKNKLEEKANKAMININIFM 797
3ZUQ_A        731 MYGLIVAQWLSTVNTQFYTIKEGMYKALNYQAQALEEIIKYRYNIYSEKEKSNINIDFNDINSKLNEGINQAIDNINNFI 810
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3ZUR_A        871 NQCSVSYLMNSMIPYGVKRLEDFDASLKDALLKYIYDNRGTL-IGQVDRLKDKVNNTLSTDIPFQLSK----YVDNQRLL 945
gi 160380522  789 NQCSVSYLMNSMIPYGVKRLEDFDASLKDALLKYIYDNRGTL-IGQVDRLKDKVNNTLSTDIPFQLSK----YVDNQRLL 863
gi 501399535  776 NECSVSYLMKKMIPLAVKKLLDFDNTLKKNLLNYIDENKLYL-IGSVEDEKSKVDKYLKTIIPFDLST----YTNNEILI 850
gi 135624     798 RESSRSFLVNQMINEAKKQLLEFDTQSKNILMQYIKANSKFIgITELKKLESKINKVFSTPIPFSYSKnldcWVDNEEDI 877
3ZUQ_A        811 NGCSVSYLMKKMIPLAVEKLLDFDNTLKKNLLNYIDENKLYL-IGSAEYEKSKVNKYLKTIMPFDLSI----YTNDTILI 885

                  ...
3ZUR_A        946 STL 948
gi 160380522  864 STF 866
gi 501399535  851 KIF 853
gi 135624     878 DVI 880
3ZUQ_A        886 EMF 888
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap