Conserved Protein Domain Family
Toxin_R_bind_N

?
pfam07953: Toxin_R_bind_N 
Click on image for an interactive view with Cn3D
Clostridium neurotoxin, N-terminal receptor binding
The Clostridium neurotoxin family is composed of tetanus neurotoxin and seven serotypes of botulinum neurotoxin. The structure of the botulinum neurotoxin reveals a four domain protein. The N-terminal catalytic domain (pfam01742), the central translocation domains and two receptor binding domains. This domains is the N-terminal receptor binding domain,which is comprised of two seven-stranded beta-sheets sandwiched together to form a jelly role motif. The role of this domain in receptor binding appears to be indirect.
Statistics
?
PSSM-Id: 311760
View PSSM: pfam07953
Aligned: 19 rows
Threshold Bit Score: 168.714
Threshold Setting Gi: 728992
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3FFZ_B        859 NDKYVDTSGYDSNININGDVYKYP-TNKNQFGIYND-K-LsEVNISQNDYIIYDNKYKNFSISFWVRIPNYDN--Kiv-- 931
gi 160380522  885 SNHLIDLSRYASKINIGSKVNFDP-IDKNQIQLFNL-E-SsKIEVILKNAIVYNSMYENFSTSFWIRIPKYFN--Si--- 956
gi 123308134   40 NDIISDISGFNSSVITYPDAQLVPgINGKAIHLVNN-E-SsEVIVHKAMDIEYNDMFNNFTVSFWLRVPKVSA--Shleq 115
2VXR_A         60 GGRLIDSSGYGATMNVGSDVIFND-IGNGQFKLNNS-E-NsNITAHQSKFVVYDSMFDNFSINFWVRTPKYNN--Ndiqt 134
gi 75397894   872 DNNLIDLSGYGANVEVYDGVELND---KNQFKLTSS-T-NsEIRVTQNQNIIFNSMFLDFSVSFWIRIPKYKN--Dgiqn 944
gi 75390620   880 KNALVDTSGYNAEVRLEGDVQVNT-IYTNDFKLSSS-G-D-KIIVNLNNNILYSAIYENSSVSFWIKISKDLT--N---- 949
3V0C_A        885 SNHLIDLSRYASKINIGSKVNFDP-IDKNQIQLFNL-E-SsKIEVILKNAIVYNSMYENFSTSFWIRIPKYFN--Si--- 956
gi 500754156  878 NNKFIDISGYGSNISINGDVYIYS-TNRNQFGIYSS-KpS-EVNIAQNNDIIYNGRYQNFSISFWVRIPKYFNkvN---- 950
4KBB_A         40 DNNLIDLSGYGAKVEVYDGVELND---KNQFKLTSSaN-S-KIRVTQNQNIIFNSVFLDFSVSFWIRIPKYKN--Dgiqn 112
1FV2_A         50 NDIISDISGFNSSVITYPDAQLVPgINGKAIHLVNN-E-SsEVIVHKAMDIEYNDMFNNFTVSFWLRVPKVSA--Shleq 125
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3FFZ_B        932 nVNNEYTIINCMrDNN----S-----GWKVSLNHNEIIWTLQDNAGINQKLAFNyGNANGISDYI-NKWIFVTITNDRLG 1001
gi 160380522  957 sLNNEYTIINCM-ENN----S-----GWKVSLNYGEIIWTLQDTQEIKQRVVFKySQMINISDYI-NRWIFVTITNNRLN 1025
gi 123308134  116 yGTNEYSIISSMkKYSlsigS-----GWSVSLKGNNLIWTLKDSAGEVRQITFR-DLSDKFNAYLaNKWVFITITNDRLS 189
2VXR_A        135 yLQNEYTIISCI-KND----S-----GWKVSIKGNRIIWTLIDVNAKSKSIFFEySIKDNISDYI-NKWFSITITNDRLG 203
gi 75397894   945 yIHNEYTIINCI-KNN----S-----GWKISIRGNRIIWTLTDINGKTKSVFFEySIREDISDYI-NRWFFVTITNNS-D 1012
gi 75390620   950 -SHNEYTIINSI-KQN----S-----GWKLCIRNGNIEWILQDINRKYKSLIFDySESLSHTGYT-NKWFFVTITNNIMG 1017
3V0C_A        957 sLNNEYTIINCM-ENN----S-----GWKVSLNYGEIIWTLQDTQEIKQRVVFKySQMINISDYI-NRWIFVTITNNRLN 1025
gi 500754156  951 -LNNEYTIIDCIrNNN----S-----GWKISLNYNKIIWTLQDTAGNNQKLVFNyTQMISISDYI-NKWIFVTITNNRLG 1019
4KBB_A        113 yIHNEYTIINCM-KNN----S-----GWKISIRGNRIIWTLIDINGKTKSVFFEyNIREDISEYI-NRWFFVTITNN-LN 180
1FV2_A        126 yGTNEYSIISSM-KKH----SlsigsGWSVSLKGNNLIWTLKDSAGEVRQITFR-DLPDKFNAYLaNKWVFITITNDRLS 199
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....
3FFZ_B       1002 DSKLYINGNLIDQKSILNLGNIHVSDNILFKIVNCSY-TRYIGIRYFNIFDKEL 1054
gi 160380522 1026 NSKIYINGRLIDQKPISNLGNIHASNNIMFKLDGCRDtHRYIWIKYFNLFDKEL 1079
gi 123308134  190 SANLYINGVLMGSAEITGLGAIREDNNITLKLDRCNNnNQYVSIDKFRIFCKAL 243
2VXR_A        204 NANIYINGSLKKSEKILNLDRINSSNDIDFKLINCTDtTKFVWIKDFNIFGREL 257
gi 75397894  1013 NAKIYINGKLESNIDIKDIGEVIANGEIIFKLDGDIDrTQFIWMKYFSIFNTEL 1066
gi 75390620  1018 YMKLYINGELKQSERIEDLNEVKLDKTIVFGIDENIDeNQMLWIRDFNIFSKEL 1071
3V0C_A       1026 NSKIYINGRLIDQKPISNLGNIHASNNIMFKLDGCRDtHRYIWIKYFNLFDKEL 1079
gi 500754156 1020 NSRIYINGNLIDEKSISNLGDIHVSDNILFKIVGCND-TRYVGIRYFKVFDTEL 1072
4KBB_A        181 NAKIYINGKLESNTDIKDIREVIANGEIIFKLDGDIDrTQFIWMKYFSIFNTEL 234
1FV2_A        200 SANLYINGVLMGSAEITGLGAIREDNNITLKLDRCNNnNQYVSIDKFRIFCKAL 253
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap