Conserved Protein Domain Family
DUF1688

?
pfam07958: DUF1688 
Protein of unknown function (DUF1688)
A family of uncharacterized proteins.
Statistics
?
PSSM-Id: 311764
View PSSM: pfam07958
Aligned: 131 rows
Threshold Bit Score: 530.898
Threshold Setting Gi: 504243627
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123501028  14 LQSPQAVRDRCRLLLERVLAGESeHFRLDLNRMGSVADYVITTMRAHYPTGE---IPFHSRWQHFQVGS-----GERLAR 85
gi 81617634   15 LLSPLAIRQSAEKILELTKSGQT-HFHYHDDQFEPVVDYVIEVIRQNYPALE---IPFHSRWGHFRAGG-----VDRVKI 85
gi 81376999   43 LRDPDTIRTRSHRILNLAKQNRLeHFSLNPERMTTTASYIVDIITSRYPELD---IPYHSRWRHFEMDG-----LPRIHN 114
gi 298708830  19 LRSLACIRERCGVIFDAAKSDKLaHFRLDLSKMDDVATFVQGLMDRDYSSYDd--VPYHSRWRHFEAGG-----LDRTAR 91
gi 505283354  15 LLSPAAIRERAQKILQLTESGKG-HFEYHPEKLDETVDYVLSVIRQNYPDLN---IPFHSRWGHFRAGQ-----IDRAKK 85
gi 644963909  15 LQALPTIRKQAQRLFNLACQDKLkYFAVDMQQLTATASFVLDVIYDQYPKLD---IPYHSRWRHFEAGG-----VDRIKA 86
gi 499838287  33 LLSAEAVRTRCAVVTDFVASGESeLFTWHPDRVHAIADYVAATIRRRYPTLQ---VPYHSRWRHFESGGpgqatINRWQI 109
gi 301118284  12 LRSLPSIREGCHRVLDLGKQDKLpNFSVVESKVPALADYVISVIRQLYPTPNeanVPFHSRWRHFETGN-----PQRVEK 86
gi 489731417  15 LMDPSSIRIRSQAILELIKHDKSaYFALETEKLTSTASFIIEVMQDNYPDLD---IPYHSRWRHFEAGG-----IDRIKS 86
gi 504009297   8 ILSAKAVRERTAKIFDLTLEGKT-NFNYHEDKLEGVSKFVLEVIRENYPDLK---IPFHSRWGHFQVGS-----VDRNAK 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123501028  86 LENRLK-DM--DPLE--RLRCKWDLAIVSVLLDAGAGSAWKYRDpesqTA---VGRSEGLALASFDWFWQGGFSSD-PqQ 156
gi 81617634   86 LQEQIQ-SF--DALE--KARIKLDLVITSVLLDAGAGNIWSFHEqstqKD---FARSEGLGVASFYLFMEGALSDD-AdK 156
gi 81376999  115 LRKQLD-PI--SPSE--WGKILYELVIISVFLDAGAGPLWRYKEalteKE---YSRSEGLALASLYLYESGAFSAD-PtN 185
gi 298708830  92 LTAAWDgSKscDELE--KARRLVDLVVTSVLLDAGAGDVWKYTEk---STgfeAGRSEGLGVASFHMFGAGAFSSDtGsN 166
gi 505283354  86 FRSLLDpT---DKME--RVRSQLDLVITSVLLDAGAGADWKYLEe---STkksFARSEGLGVASYYMFTSGVMCSDg--Y 155
gi 644963909  87 LQLKLAs-F--SPEE--RGKIFYELVIISVLLDAGAGKHWHYIEp---DTglkLSRSEGLAVASLALYLKGAFSAH-PeQ 157
gi 499838287 110 LCERAGmSG--PEHReeRARIGIDLVIPSVLLDAGAGPDWRYRDaasdMM---LTRSEGLGVASFDLFARGGFSAG-QgD 183
gi 301118284  87 MTSTWHc----DKLE--KARRLLDLALVSVLLDAGAGPTWKYKEpgteDF---YSRSEGLGIASFHMFVAGNFSVDpEkD 157
gi 489731417  87 MQEQLS-AL--SIDE--RGKILYELVIISVFLDAGAGPYWCYKDpetgAT---YSRSEGLALASLSLYQKGIFSSL-PsE 157
gi 504009297  79 LDSELS-SL--DKVE--RARVKLDLVITSVLLDAGAGPTWKFDEe--gES---YNRSEGLGVASWHMFINGAFSND-G-- 145
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123501028 157 PLQVDAAGLERITLADLAAAFQVGPE-NPLLGLEGRWQLLQRLAQTLRAqPHYF---GsghnlPRPGRLWDAIQp-EDp- 230
gi 81617634  157 PLQATAKGLQNLTTQKLSEVFQVSAQ-NPLVGVEGRLSLLQNLGKTIEQkKGLFp--G-----GRPGSLVDYLR--ARy- 225
gi 81376999  186 PFRVDAERLLDFKETDLIKGFQVSST-NLLEGIPGRVSLLNRLGEIIHRkEHCF---Nr---rKRLGEFYTYVEs-LQd- 256
gi 298708830 167 PHRADSLGLKGLADDSVRRAFQVDDGvNPLVGCDGRTQVLKRLGTALEQhPVFFeagGi----FRPGNMVDYLLa-QAsd 241
gi 505283354 156 SMKADQEGLLKVTASDLKKYFQVSDS-NPLVGVEGRVQLLNNLGKAMENrT-IF---Kd----GRPGNIVDYLAa-KCg- 224
gi 644963909 158 PWRVDSKRLLAFSEVDLRHGFQVDAD-NLLEGVAGRVKLLNRLGAILAKeTDYFg--He----GRLGDFYTYIAs-LQf- 228
gi 499838287 184 PLRSDADRLCRIDASTIASAFQVAQH-NPLVGLEGRAGLLRRLGEVMQDtPAVF---Gs---pARLGNLYDYLAs-HAr- 254
gi 301118284 158 PHRVDATALANLPDEAISDAFQVTDA-NPLVGCAGRTDLLKRLGKSISNyPEFFs--Gad-gsIRPGNMVDYLTkhQNa- 232
gi 489731417 158 PFRVDAARLVTFNEHELRQGFQVTQS-NPLEGISGRVALLNRLGSLIQHdEQHF---Gk---eHRLGNFFTYISs-LAn- 228
gi 504009297 146 SRRADAKKLMEISKTDIEKAFQVSEK-NPLVGAQGRAGLLASLGKCIESkPEIFk--D-----GRPGNIIDYMI--GEh- 214
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123501028 231 -sRGIKAAQVFQAVQRGFSSIWP-GRVSLAGIPLGDVWPYPHLPqt-epGsHWVPFHKLSQWMTYSLLEPLQQ-EGIPIG 306
gi 81617634  226 -gDRITGPQLLRAVLDGLGEIWP-GRVKVAGVNLGDIWNYSKVP-----G-GLAAFHKLSQWMTYSLIEPLLE-AGFEIT 296
gi 81376999  257 -nKILPTTKLFEAVLETFNDIWP-VRLIYHGVSLGDVWIHSALktne-agsEYIPFHKLSQWLTYSLVEPLEQ-TGIDIA 332
gi 298708830 242 dsKTVSITKVWEVVMYGFEAMWPaGRTELDGRSMGDVWEHSALPddgsgWsNLVPFHKLSQWMTYSLMEPLQA-AGLVLT 320
gi 505283354 225 --QTIPATEIFRAVLDGLGVIWP-GRLSANGVNLGDVWRHSQLGda-gsFeSLVPIHKLSQWMTYSLIEPIEE-AGFKVT 299
gi 644963909 229 -kQTIATHQLFQSVLAGFGNVWPe-RLRFHGVALGDVWCHPSLKtd-apGsEFIPFHKLSQWLTYSLMEPLEQsA-IQVT 304
gi 499838287 255 -eGRIEASFVLRTLLVALGPVWP-GRLQIQGISLGDCWRHPAA------PeGMVPFHKLTQWLTYSLLEPLED-AGLTVT 325
gi 301118284 233 -sGEVSVTDLWKAVLNGLQDIWPaSRTQIDGQNMGDVWELSYLPeh-ekAgKFVSFHKLSQWMTYSLMEPLQD-AGFKIT 309
gi 489731417 229 -hKQLTAKQIFQTVLNTFNEIWP-TRLLFHGVSLGDVWQHKALktne-pgsEYIPFHKLSQWLTYSLIEPLEH-TGISVT 304
gi 504009297 215 -gQKFAATDLLKAVLLHFGDIWP-SRITVDGVSLGDVWNHPSLGek-ddLnSLVAFHKLSQWLTYSLIEPIVE-AGCEVH 290
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123501028 307 GLDELTGLAEYRNGGLFVDLGVIQLKQPEIG---------QQPHPPDSTVIVEWRALTVILLDQVASLIRERLGCSAQEL 377
gi 81617634  297 EVERLTGLAEYRNGGLLLDRGLISLKDPGMA---------EQSHRPDSELVIEWRGLTVSLLDRIGQQVQSKLNKSPSEF 367
gi 81376999  333 DLDVLTGLPEYRNGGLLIDTELLKVRNNKIL---------EQPQDPGSEPIVEWRALTVALLDELALLIRQQLNMNAESL 403
gi 298708830 321 ETELMTGLPEYRN---------GGLLLDMGLleakhpgvtGQAHGPEEEVIVEWRALTVCLLDEVAAALRQKLGKTEKEF 391
gi 505283354 300 QVEGLTGLAEYRNGGLMLDSGLLTLRNPEAAq---------tPLTPDMDLIVEWRALTVLLLDMIGERVQKALNKSAEDF 370
gi 644963909 305 GLDDLTGLPEYRN---------GGLLLDLGLlrlknkenyQQPQDPGSELIVEWRGLTVALLDEIAKVIRRQLGRTSSDL 375
gi 499838287 326 GLDALTGLPEYRNGGLLYDFELMVPRDATFA---------SRAHAVDEPEIVEWRALTVTGLDLIADGVRQALGLSEADF 396
gi 301118284 310 DLKLMTGLPEYRNGGLLVDFGVLVPKSANIL---------TDEFDPSTEVIIEWRALTVAILDELHKVILGRLNFTADLF 380
gi 489731417 305 HLDELTGLPEYRNGGLLIDCELLRIKDNKDL---------EKAYLPDAEIIVEWRALTVILLDELAEVIRKKLRKNQTEL 375
gi 504009297 291 SVNEMTGLAEYRNGGLLIDMDLISLKDPALL---------EVAHKPDSEVIIEWRALTVCLLDKIADIVRKELNFSEEEF 361
                        410       420       430
                 ....*....|....*....|....*....|....*....
gi 123501028 378 PLVKILQGGTWTAGRQIAAQLR-PDASPPIQLLSDGTVF 415
gi 81617634  368 PLAKVLEGGTWWAGRKAAKALR-ADSSPPLKIESDGTVF 405
gi 81376999  404 PLAKILQGGTWEAGRQIAQKKR-INGTPPIEIISDGTIF 441
gi 298708830 392 PLVKMLEGGTWKAGRYMAKTLRpQTCGPPIEIVSDGTVF 430
gi 505283354 371 PLAKVLEGGTWWAGRFIAQQKR-AGGTPPLNIQSDGTVF 408
gi 644963909 376 PLAKILQGGTWEAGRRIAKQKRiE-GTPPIQIISDGTIF 413
gi 499838287 397 PLARVLEGGTWAAGRRVAAQRRpPGGPPPFAIQSDGTVF 435
gi 301118284 381 PLVKMLEGGSWKAGRVIAKEKR-ADGGPPIKIKSDGTVF 418
gi 489731417 376 PLAKILQGGTWEAGRRIARQKR-PLGSPPLQIISDGTVF 413
gi 504009297 362 PLAKVLEGGTWWAGRRVAKQKR-EDSSPPLKLDSDGTVF 399
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap