1HTR,3PSG


Conserved Protein Domain Family
A1_Propeptide

?
pfam07966: A1_Propeptide 
Click on image for an interactive view with Cn3D
A1 Propeptide
Most eukaryotic endopeptidases (Merops Family A1) are synthesized with signal and propeptides. The animal pepsin-like endopeptidase propeptides form a distinct family of propeptides, which contain a conserved motif approximately 30 residues long. In pepsinogen A, the first 11 residues of the mature pepsin sequence are displaced by residues of the propeptide. The propeptide contains two helices that block the active site cleft, in particular the conserved Asp11 residue, in pepsin, hydrogen bonds to a conserved Arg residues in the propeptide. This hydrogen bond stabilizes the propeptide conformation and is probably responsible for triggering the conversion of pepsinogen to pepsin under acidic conditions.
Statistics
?
PSSM-Id: 336882
View PSSM: pfam07966
Aligned: 132 rows
Threshold Bit Score: 32.296
Threshold Setting Gi: 341884635
Created: 26-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30
                  ....*....|....*....|....*....|
1HTR_P          2 VVKVPLKKFKSIRETMKE-KGLLGEFLRTH 30
gi 332264729   21 LVRIPLHKFTSIRRTMSEvGGSVEDLIAKG 50
gi 395851770   21 LIRIPLYKFKSIRRTMSEaAGPVEELIAKG 50
gi 16119024    19 VIRIPLTGFKNVRRRLMEvGTPVEQLNFTS 48
gi 47213062     8 LPRIPLNKFRSIRRELTDsGRQVEELLADR 37
gi 597773809   19 IVRIPLKKFRSIRRSMTDsGRAMEELLADS 48
gi 1108900620  21 IIRVPLHKTRTLRRLMSDnGMSVEELRALA 50
gi 831552042   21 VVRVPLYKTRSLRRLMSDnGRTVEELRALA 50
gi 158254091   21 IIRIPLHKMRTVRRMLADnGKTIDEIKSLA 50
gi 947201402   21 LIRIPLHKFPSIRRTLTEmGGPVENLIAHE 50
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap