Conserved Protein Domain Family
COPIIcoated_ERV

?
pfam07970: COPIIcoated_ERV 
Endoplasmic reticulum vesicle transporter
This family is conserved from plants and fungi to humans. Erv46 works in close conjunction with Erv41 and together they form a complex which cycles between the endoplasmic reticulum and Golgi complex. Erv46-41 interacts strongly with the endoplasmic reticulum glucosidase II. Mammalian glucosidase II comprises a catalytic alpha-subunit and a 58 kDa beta subunit, which is required for ER localization. All proteins identified biochemically as Erv41p-Erv46p interactors are localized to the early secretory pathway and are involved in protein maturation and processing in the ER and/or sorting into COPII vesicles for transport to the Golgi.
Statistics
?
PSSM-Id: 311775
View PSSM: pfam07970
Aligned: 179 rows
Threshold Bit Score: 161.217
Threshold Setting Gi: 123454020
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122016712 147 CYGAEPEP-GACCHTCEDVRRAYSLRRWVFNeDDVSVEQCAEERLRKAAILSSQ--EGCNLFVNYKVARVTGNIHFVPGR 223
gi 123361353 103 CYDFYDNR--FCCNGCEKLKEIYHSNNKTAT--PENWTQCK-----PENKQKFDpnEKCHVKGKISVNRVPGSFHLAIGQ 173
gi 154415829 129 CHGLKPEG--ECCNTCDEVKAIFEARGEDFN--PLPFDQCM-----GNVNFKKDmsESCLIEGTIHTFKSPGQFHIAPGR 199
gi 154418008 138 CYLSTDKK---CCNTCREVMDVFKAKGLTYY-ASFRWEQCIREGVLDFGN------ETCRIKGKLKVKKQSGNFHIALGA 207
gi 123451578 144 CYGALPQG--KCCNSCEDVINAFKAKGWGID-GIDRWQQCIDEGYADLGK------ESCNVYGDINVAHISGFLYFA--- 211
gi 123389547 123 CYGAESSQ-RKCCQTCEDVVAAYQEKGWGIG-NLSSWAQCRAE------GVMFDgkERCQAYGNLHVNAIEGGFHLAPGI 194
gi 123437985 122 CYGTEFAEgSRCCNTCEDVVSHHIKAGRPLT-NVTTWQQCINE------KYDFTgkEKCQIFGNHHVSAIDGGIRILPRF 194
gi 123472317 138 CYGAAS----GCCNTCKDVKNAFKKKGRVPP-SLSTIRQCR----DAVIDYNHIrnESCHVYGTVIVPPTHGTIVMNSGD 208
gi 123407515  18 CYGASN----GCCNSCKEVLDAFQKIEKSHP-PTAMIQQCR----NTFSDADSLinDSCTLGITLTVPHTHGSFFITIGQ 88
gi 123438593 130 CYGQKS----GCCNTCKEVRKAFKANNRPPP-PIIHIQQCV--DEGYKEELIAMkgEACRVHGTLTVHRAPGTFHVAPGE 202
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122016712 224 MFNL--MG------QHL--------HdfrgktvrQLNLSHIVHTLGFG-ERFPGQvNP-----------------MDGLv 269
gi 123361353 174 SIED--YG-------HQ--------Hilld-dyqTITFDHDIIDLRFG-ANIPMTsHP-----------------LRGTh 217
gi 154415829 200 NTKFrrTG-------HQ--------Hdtg--lspEASCPHTIHEFYVG-QKYDNVrSP-----------------IRGK- 243
gi 154418008 208 NTNDnyKG-------HS--------Hdlss-vdaSHKLNHVIHSLTFG--------EPvdyykpqltdvemqlpeLNGS- 262
gi 123451578 212 ------LEdykvgdKHPkdis-rlsH--------KYNLTHTINYLEFG-PRVSHEpGP-----------------LDGL- 257
gi 123389547 195 NVFSr--------fGHV--------Hdfsp-lvdTLNLTHEIEHISFG-APIDK--SP-----------------LDNT- 236
gi 123437985 195 SSNEepf-------------------------tkLLNLTHYIDHITFGtSFGP---QP-----------------LDDA- 228
gi 123472317 209 SYGAqmNTttsslgISI--------D--------DFNFTHKINDIYIGeNDLGD--HP-----------------LKGI- 252
gi 123407515  89 NTTNtsADylgv-------------------pkeNLNFTHSFDFFSMGgg-----yHPaq--------------iLQNY- 129
gi 123438593 203 SYNIngEH------DHYyedlginiD--------EMNFSHTINHFSIGmPTANSY-YP-----------------LDGH- 249
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122016712 270 nlrgaV-DATEEVNGRFSYFVKVVPTQYQSasilgvgsvVE-SNQ----YSVTHHFTPSPSA--ELsAAAAesspvmVPG 341
gi 123361353 218 -------IKSTGEPLATEYNLIITPIVFYAdg-----qyIEkGFEyvyfYSMTYHL---------------------VPG 264
gi 154415829 244 -----IfRDRDSLPRIYLYDLFITKVLHTFnd-----alQYtSYE----YSYNLGAKIFNPGsfY------------QPG 297
gi 154418008 263 ------------NYWMVTYYLHAAPERISTtd------kID-SYR----YSAFPSRRKVTNK-----TKKG------FPG 308
gi 123451578 258 -----TvLQEEPGLMQYNYDLEVVPTKWFSsr-----gfPVsTYK----FHPMITQKNFTEKvnRG-----------VPG 312
gi 123389547 237 -----RvVQKKPGQIHYRYNLKAVPTVKEVng------kVHrFFR----FTVNYAEIPVTARgrY------------GPG 289
gi 123437985 229 -----LiVQSEPGQFHYRYDLKAVPTVMHNqd-----gsIThGFQ----YAVDSAKIPITDRtrL------------GEG 282
gi 123472317 253 -----KkVQKEVGRYKGLYFIRTLREQKGSl----------qVYR----ATSSHYDRYREGTtgK------------FPG 301
gi 123407515 130 -----MkVQKEYGRYKAMYYIRATR--------------ILnDYDtqysLSVTSYDRYRDESsdK------------LPG 178
gi 123438593 250 -----TeIQQKTGRMKMIYFLRAVPINLDGr-----------VFS----FGASSYQNYRGSNstK------------YPG 297
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*
gi 122016712 342 VFITYDLSPIKVFVFEKHPysSVLHLVLQLCAVGGGVFTVAGLVD 386
gi 123361353 265 IYFYYSFTPYTIAVTWQSR--SFRSFLISTGGLLSGIYAIFSMVs 307
gi 154415829 298 IYFKYMFSPMTIVERSISK--NPMRFLVTSVGVLAGIFAFLNAVg 340
gi 154418008 309 IVFYYDFAPMIVVYQPTHG--SIRSIIVDICGIVGGAFSFAAIID 351
gi 123451578 313 IFLNYNLAPISLVQYEVIS--SPWKLITSVCAIVGGCFTCVSLAD 355
gi 123389547 290 IFFVYSFAPVAITSTYDRP--NITVLLARLISIFGGSFMLARLID 332
gi 123437985 283 IFFNYYFATVAVVGKPDRF--TIYILISRLFCIFGGGFFLARLID 325
gi 123472317 302 LYFNYDVSPIIVMYKRDT---TVLNFVIELMAILGGIYSLGSLLD 343
gi 123407515 179 VFINYDISPLILQYVLDR---PIYQIIIDMMAIIGGIFAFGLLID 220
gi 123438593 298 VFFSYDVSLIGIVSSQNS---SLMDLVTELMSILGGVFAIATFLD 339
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap