1VQY


Conserved Protein Domain Family
NIPSNAP

?
pfam07978: NIPSNAP 
Click on image for an interactive view with Cn3D
NIPSNAP
Members of this family include many hypothetical proteins. It also includes members of the NIPSNAP family which have putative roles in vesicular transport. This domain is often found in duplicate.
Statistics
?
PSSM-Id: 311781
View PSSM: pfam07978
Aligned: 34 rows
Threshold Bit Score: 65.0333
Threshold Setting Gi: 81776284
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VQY_D        15 VE--ERIYRIRGGKXQEY-LKLVREEGIAIQAPILGNLIGYFVTDIGP-LSQVIHXWGYASLDDRAERRGKLAEDQRWq- 89
gi 81737808    7 VD--LRVYTIRLRKMAEF-IEVFDRLAIPVQLKYLGRPLGMFTSAVGP-LNQIVHLWGFPDMGEFERRHAERDKDPDWp- 81
gi 123546224   1 mitcVITYDIDPNRQELF--AQYARNWGACSPRCGADLIGYYAPHEGS-TSTAYGIYSLPSLADYEAYRSRLAADPLGr- 76
gi 81778819    2 TItcFIRYEIDPFGKAAF--EEYARNWGQAIPRCGADLIGYYAPHEGS-ATTAYAAYNIENLAAYEAYRARLAADPAGk- 77
gi 81780246   48 YE--LRIYDCLPGRLPAL-LKRFSDQTLAIWERLGIRQAGFFTTVIGEnSNRLTYFLAWESMAEREAKWAAFVTDPAWhr 124
gi 81736861    3 YE--MRVYRCVPGRLPAL-LKRFETATLKLWEKHGIRQAGFFTTLIGEsSQELTYFLAWESLAEREKKWGAFVTDPDWle 79
gi 81562400   71 YE--SRVYRCVPGKLPAI-LKRFETITLKLFEKHGIRQDGFFTTLVGAsNQELTYLLAWESLAEREQKWTAFATDPEWla 147
gi 81660564  160 YE--LRLYESANERLGDLkVEMFNAGEVPIFLDSGIQPIFIGQALVGPqMPSLTYLTVYKNEAAREKAWDAFRAHPDWk- 236
gi 81776284   19 VE--LRQYTLNPGQRETL-IALFDREFIESQEATGMTIIGQFR-DLDR-PDMFVWLRGFDGMDTRKEALAAFYDGPVW-- 91
gi 493356027   1 MLtcFIRYEIDPFKVDAF--ERYARNWGEAIPRCGADLIGYYAPKEGS-STIAYGVYNIENLAAYEAYRARLAADPAGr- 76
                         90       100
                 ....*....|....*....|....*..
1VQY_D        90 AFIPRLSVL--IESSENRILLPTDFSP 114
gi 81737808   82 AYLQASEHL--IVAQENRLIR-----R 101
gi 123546224  77 ENYEFAKREgfIRRESRLFVKLASaph 103
gi 81778819   78 ANYEFAKRErfILKEDRMFLKHVS-GP 103
gi 81780246  125 AVDESQRDGqiIANISSQLLTPTAFSS 151
gi 81736861   80 ARSKSEADGqiVGNIVSQLLTPTAFSA 106
gi 81562400  148 AKAETEKDGqiVDTITNQLLVPTAFSA 174
gi 81660564  237 VLSKNPRYGgtVSRIDKFVLSAKPYSQ 263
gi 81776284   92 AAHRDAANAtmTDSDDVLLLKPAWPSA 118
gi 493356027  77 ENYEFARREqfIRREDRLFLRLAS-AP 102
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap