2YUH


Conserved Protein Domain Family
TBCC

?
pfam07986: TBCC 
Click on image for an interactive view with Cn3D
Tubulin binding cofactor C
Members of this family are involved in the folding pathway of tubulins and form a beta helix structure.
Statistics
?
PSSM-Id: 311787
View PSSM: pfam07986
Aligned: 43 rows
Threshold Bit Score: 100.753
Threshold Setting Gi: 74632584
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2YUH_A        30 QRDVLLTELSNCTVRLYGNPNTLRLTKAHSCKLLCGPVSTSVFLEDCSDCVLAVACQQLRIHSTKDTRIFLQVTSRA-IV 108
gi 122046402 310 SSSYTIEKCSQSSLYITSDLPHTRLSQLVNCTVAIGPVGGVLCIDRCENCNISALCAAIVVGQCKNVTIFVCTNTPP-VL 388
gi 75163943  337 GRSVKVVNCHDSVIYLLAPLRYATVHGCSDTTIVLGAVGKAIKVEHCERVHVIVAAKRVCIANCRECVFFLGVNQRP-LI 415
gi 158706346 329 GAHVKIHRCNESFIYLLSPLRSVTIEKCRNSTFVLGPVQTALHLHSCDNVKVIAVCHRLSISSTTGCIFHILTPTRP-LI 407
gi 158706348 329 DARVKIHRCSDCYIYLLSPLRSVTVEKCQNCTIVLGPVQTVLHIQMCYNVKIIAVCQRLSLLSTTNCTFHVLTPTRP-LF 407
gi 215277024 330 DVNIKLHRCSEAFIYLLSPLWSVTLDKCRNSTLVLGPVRTSVHIQSCENVRVVCVAGRLTIGGSFNCTIHSLTPTRP-LL 408
gi 74855518  132 SVKLNLSNNKKSTIYILVNIAICTISNCHDSIIILGPCIDFIELSDCSKLTIISITKSIRIKSSNNISLYICCNQKP-II 210
gi 47213196  321 GSNVKIHRCSGAFIYLLSPLRSVTVDKCHDCTVLLGAVETSVHLHRCQNVQLVCVTARVIASASSCCTIHALTPTRPlLL 400
gi 156352139 329 GSNLKIHRCHYSYIYVLCPLRSVTITKCHDSTIVLGCVNTAVNIIGCQNVLFIMISNQVSMSACLNCSFHLCTPTRP-LI 407
gi 123491592  80 CPSAHIHNCKHLRIYFCGVMSSVFISHCKDSIVFIGAASSAIRMEYCANVTVVASTRFIHLDACTRCSVYILTNNRP-LI 158
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
2YUH_A       109 ------EDCSGIQFAPYTWSYPEIDKDFESS-GLDRSKNN-WNDvdDF 148
gi 122046402 389 ssydgvSTLENVRFAPYNSHYSTLEEHLASS-GVNP-KLNlWNV--GL 432
gi 75163943  416 v-----GDNHKLQVAPYNTFYSHLEEHMREV-GLEPTINK-WDKplal 456
gi 158706346 408 l-----SGNQRVTFAPFHTHYPMLEDHMART-GLAT-VPNyWDN--PM 446
gi 158706348 408 y-----CGNQGVVLAPFHISYSMLEDHMAHT-GLAT-VPNsWDR--PF 446
gi 215277024 409 l-----PGNASLTLGPFHTQYPTLEDHMASA-GLAV-VPNlWNQ--PL 447
gi 74855518  211 a-----SDCIAIKLAPYNTHYPNLEQQLITSkLSTTLSNNcWNT--PI 251
gi 47213196  401 ------PGNTDITLAPFHTFYPSLEDHMASV-GLAVVPNV-WDQplll 440
gi 156352139 408 l-----TGNEGLTLAPYHTFYPKLEEHLKSPwGVATFPNE-WNNplll 449
gi 123491592 159 t-----GNCTKILLAPYNALYSKLPADLLCA-GINPNNNR-WKEpmvi 199
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap