Conserved Protein Domain Family
DUF1702

?
pfam08012: DUF1702 
Protein of unknown function (DUF1702)
This family of proteins contains many bacterial proteins that are encoded by the UnbL gene. The function of these proteins is unknown.
Statistics
?
PSSM-Id: 311805
View PSSM: pfam08012
Aligned: 32 rows
Threshold Bit Score: 400.058
Threshold Setting Gi: 505434175
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 753787152   1 MAGSIRKLLTAPDLGSTSFETLGY--------DTKHAPARTQLEASARQFIIGYEFGIEQREHTGLVDRLEALQ-REYRG 71
gi 504914226   4 TLGSLRRLALAPSLEEVAFRARGF--------PGASSEYAARLEAIPQSVVCGFEWGIDSRDGWEVARRLAFVE-PGLRG 74
gi 374657914   4 FLGAMRQYLLAPRLSAVTLADRDL--------PGAASPSAQRLEAIPQAVVCGFEWGMAARDLWEVERRLELVE-VEHRG 74
gi 506275181   4 FLGTARRMALAPSLDAVTIGKRGF--------PGADSPSASKLDLVPQTVICGFEWAIEARSMAHVQRRLSVVD-PELRG 74
gi 503085599  32 pWEWLRKQLFSLSPEEATFKRRGF--------YASVAEIQEHLETIGCTFVEGYQAVINDENPEIFLGKLKASE-AELAG 102
gi 503498783   4 VLGSLRRLALAPALSEVGFARRGF--------PGPSSPATARLEAIPRAVVCGFEWGIDCRGLEEVQQRVELVD-EGMRG 74
gi 501591751  26 VFGQLRQTLLRISRKEATFAKRGF--------LPTHPKTQKHLETIGKTFLQGYEIAIALSHPPSVITQLNEIA-TEYRG 96
gi 166086388  45 qvnrfpQRLLLLSPQAATFNQRGFicdpqsrsPAVQPQKQIYLETIGQTFIYGYNAAIMAHSLTDLFPLLEGVT-LNLRG 123
gi 516450290   4 FFGRCRHALFGISDAETRIELRGF--------KVGDDRVKARIERIGKSFVEGYHAALLDNDPLRLTEHLNAIDdNELRG 75
gi 262077357  16 wllSIKVRLFGIADEEATFERRGF--------TASHPVIRHRLESIGFTFIHGYMVALRCTDPNSMAIALAEVE-PAQRG 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 753787152  72 FAYEGAVMALSMRDVMSPlPGRRRTESFLAGPGyddgpgSRHIFMAYIGLGFAIARLPGAMWRRALP-----------RQ 140
gi 504914226  75 FAHEGAVMAFTIRDVM---GRGTRVRDLLRGDG------ADHLFVAYIGIGFAMARLPRGLWRKVMP-----------DL 134
gi 374657914  75 FAYEGAAMAFTVRDVMAG-GRGRRTERLLRGPG------ARHLLLAYIGIGFAMARLPRPLWRHVIP-----------DL 136
gi 506275181  75 FAYEGATMAYTVRDAF----GGHRTRELLLDTG------APHLFVAYIGIGFAMARLPRRLWSKVVP-----------DL 133
gi 503085599 103 FAFEGAAMALFLLDQLTP-WRGDRFLEFVGGPG------NPYIYMSYVGAGWGLARLQWRLKPYLHQls-------cgAS 168
gi 503498783  75 FAYEGVTMAFTVLDAMGS-GRRRRTRELLLGPG------APHLFLAYIGIGFAMARLPRPLWRKVVP-----------EL 136
gi 501591751  97 FAFEGAAMGLGLLDYLTP-WNRTRIGEFLASEG------VNHIYMTYMGMGWLLARLSGSIQSYLTRiqesdlnlsphPI 169
gi 166086388 124 FAYEGAAMALSLLDCLTL-GKCDRFEHFLANEG------KKHIYMAYVGKGWQLARIPFSLRFYLQKl---------aDS 187
gi 516450290  76 FLFEGAAMGLVISDFLCP-WRPSRFQAFLTGPA------QHHAYMLHVGAGWALARLP------VSP-----------AS 131
gi 262077357  87 FAFEGAAMAMALQDLLSP-WRRNRLQNLLKGAG------RAHSYMVYIGAGWAFARLRLGQGRYFRR-----------M- 147
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 753787152 141 SKLPDHPSLRGLILDGYGFHMAFFHHTKWVDGQYAPPRYHWPAPHTLTQRVVDQGVGRAMWFVYGGDVERLMEAVERFGP 220
gi 504914226 135 SGSPYHPTVSWLAVDGYGFDLAYFHTRTWVDRQRVPAPYPWQGNADYFPRAVDQGIGRALWFIHGARCEEVTAAVRRFDP 214
gi 374657914 137 DGMRYHPTMSWLAVDGYGFDLAYFKTRLYVGGQRVPAPYPFQGAPDYFPRAVDQGIGRALWFIHGGDPSGVVAAVNAFDE 216
gi 506275181 134 GDTKYHPTMSWLAVDGYGFDRAYFDTAKWIDRQYVPAPYPWAGAPHYFPRALDQGIGRALWFMHGARPDGVAGAIARFAP 213
gi 503085599 169 VGQFPDPLLGWLAIDGYGFHQGYFQGRKYIETLAFPSELS---AWSYALKVFDQGLGRSLWFVQGADVARIAQKIQQFPP 245
gi 503498783 137 DPGPFHPTMTWLAVDGYGFDLAYFDVAKWVDEQRRPAPYDWQGHRDYFGRAVDQGIGRALWFIHGARVLDVDAAVRRFAP 216
gi 501591751 170 IPSPPHPLIGWLTIDGYGFHQGYFHWQDYIQNLKPPTNLS-----GYSCRVFDQGLGRSLWFVKGANILAIEAAIAQFDP 244
gi 166086388 188 AQHFPDSLLGWLALDGYGFHQGYFAWPKYIRERKSPQELS-----GYARLVFAQGLGRSLWFVKGANIAEIADQIQKFDP 262
gi 516450290 132 LTSRMDCLLRWLVLDGYGFHEGYFHWPDSIGRQQRPSCLQ-----GYEKRAFDQGLGRSLWFVMGADPERIVSALQDFPT 206
gi 262077357 148 -----DPLLRWLAIDGYGFHEGYFHPRRTIDASKQPR-----GLRGYGHRAFDQGLGRSLWFVCGADAERITRTIAKLAP 217
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 753787152 221 ERRSDLMSGAGLAASYAGGVDDDALDLLWTKGHQYRPELAQGAVWALRARDVSNLITPENEAAAQRFCGCSAVEASQIAA 300
gi 504914226 215 ARHADLWSGVGLAATFAGGGTPDELGTLPGAAGAHRAELAVGAVFAAQARIHSGFVPEHSTIALDVFTGTTPEAAAELVD 294
gi 374657914 217 ARRADLWSGVGLAATFAGGCEADGLAAVRDAAGSHRSQLALGAVFAITARHAAGFVAAHSRLGTEVFTGLSVEQAVALAD 296
gi 506275181 214 ARHADMWSGAGLAASFAGGCDAEGYARLRELSGPHQGHVALGAVLAAKARDYADYVPEYTATAVQVLGGLSVSDASALAD 293
gi 503085599 246 YRRADLWSGVGLACTYAGGVDRASIEQLRRLAAAYLPQIAQGAAFAAKTRIRAGNMTENTEMCCQVLCGMSAEPAATITD 325
gi 503498783 217 ERHADLFSGVGLAATFAGGCGEADLATLRREAGEHAPELALGSVFALRARVHAGFVPPHSAVAAAALSGLSVPAAVALAD 296
gi 501591751 245 MRRADLWSGVGLACGYAGGVEKTALERLKAMAQPYYSQLAQGVAFAAKTCIRAGNLTEHTEIAAQVLCGMSAQQAAQITD 324
gi 166086388 263 LLQPHLWSGIGLACTYAGGVSPEEIQHLKQLAEPYRAELAQGAAFAAKARLLAENCQENTEIACQILCGMAITETAKITD 342
gi 516450290 207 DRQGDLWSGVGLAGAYAGGVEPDDLERLKVLAGDFLAHLAQGAAFAAKARQRAGNPADHTKLACRIFCNLSAEHAAQLTD 286
gi 262077357 218 ERHEDLWSGIGLAAAYAGGVSATDLEMLRKLAGAYLPAVAQGAAFAAKARQRAGNPTEHTELGCNIFCGESLRESAHATD 297
                        330       340
                 ....*....|....*....|....*...
gi 753787152 301 DVAEKLPL-DSS-LATYEEFRRRVRLRF 326
gi 504914226 295 ATAVEPAD-NGP-VPAYERWRGGIRAHF 320
gi 374657914 297 RTESNPVEpTTA-EPLYEQWRSRIRAHF 323
gi 506275181 294 EASSAGEV-AGP-EPSYELWRLGIRAHF 319
gi 503085599 326 LSLIGLSS-QAT-TPAYEIWRQRIQNHF 351
gi 503498783 297 DTAPAPDA-GGS-VPPYERWRANIRRQF 322
gi 501591751 325 DTLVGLFD-TPE-ITAYEQWRQRIQNQF 350
gi 166086388 343 DTLIGLDY-HDQ-IPAYEQWRQAIQSHF 368
gi 516450290 287 DALRKVPA-DNA-LPAYEHWRQRIRRHF 312
gi 262077357 298 AVLEGLGG-DTSdQPAYEQWRQRIQHYF 324
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap