Conserved Protein Domain Family
DUF1705

?
pfam08019: DUF1705 
Domain of unknown function (DUF1705)
Some members of this family are putative bacterial membrane proteins. This domain is found immediately N terminal to the sulfatase domain in many sulfatases.
Statistics
?
PSSM-Id: 311809
View PSSM: pfam08019
Aligned: 163 rows
Threshold Bit Score: 56.753
Threshold Setting Gi: 524086543
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81614771   54 AIMNAIFTLLVWPYVHRVIIALVIILSTFATYAMYNYGAYFNYGMIVNVFETNSGEAGSYFSVTLLLWIITLAVIPIFLL 133
gi 81665738  374 PLLLALIS----FKLTKIWFAIISITNAIAVYFVSVYGVFLDKTMMGNLFNTNPAEAGEFLSLKMALYIVILGLLPACFL 449
gi 81555770   63 FLALGLIS----ASLMRWSAIVFSLLNSVAFYFISAYKVFLNKSMMGNVLNTNTHEVLGFLSVKLFVFIVVFGVLPGYVI 138
gi 269987983  18 GLQWFLLLLVINRWTFKWVTISLFLITSIAVYFMNTFHVYIDSTMITNVMSTDYHESREFLQWRILPYFLLLGVLPCLLI 97
gi 505246702  60 tFSFVVLASFNRRAIFRLIASLLILLSATGAYYIAFYSVVIGHGIVESVFTTEMDLIGEILDVRLGLWVLMLGVAPALLF 139
gi 503655944  59 LAALSLLG----NKCMQAVFAFLTLCNALAFYFIHTYHVFLTRAMMGNVFNTNTHEAGAFLGGNLWFY-GLLGLGLAGLF 133
gi 495739230  61 FYLLVYLA----GLIGRIIISLFFALSAAALYFINAYSVIIDESMIGNILNTNYAESSAYFSITLALYVLVLGILPSAAL 136
gi 502452685  62 FFLMFSLL----RFVGKIILALLFIFSAIAVYFINTYGVIINAEMMGNVLNTNYAEASGFFSIKLLLYIILLGVISGIII 137
gi 505359046  63 YYLVLFLG----RFVGKCILAFTFIGNAISLYFINTYQVLITDKMMGNVFNTRYSEASGFFSWSAVWYLLFLGVVPCIYI 138
gi 501019434  82 LYVLFILS----RRLGKAVCVVFALANSLAVYFVVTYNVILDRTMIGNIFNTQYSESGQFLSPKLAIYFILLGVLPAWLI 157
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 81614771  134 NRFRVvFQSSALKEVAVKV-ASILVSLIVIVFIAMI--YYKDYASLVRNHNEIKALINPTNYLTSGFRYGKYQL 204
gi 81665738  450 LFEKVar------pTRKSLaKSLGLIFFVLIVLTGV--NFQNLLWFDKYSKQLGALIMPWSYIGNSVRYFQGEL 515
gi 81555770  139 YKIPLkn------sSKKAPfLAILALVFIFIASALA--NTKNWLWFDKHAKFIGGLILPFAYSVNAFRVSALKF 204
gi 269987983  98 WHIKIy-KRSLISYWIGRL-GTIFLSLCMVFGGGWA--VFHDLGPVHRERKEIVYLITPLNLISSSVKAYRKSL 167
gi 505246702 140 WRLSE-QHRSLLR-FRHSWkDGVLAALTLMAAVLVAvaCTKELKAVDKRAEARRGRDIPGSAALAAHRYLptnw 211
gi 503655944 134 YAIPIak------pKLKTQaGIFLGSALVFFIWSFT--HAKQWLFLDHHAKNIGGLALPYSYSINALRVALHAI 199
gi 495739230 137 LRIRTvk------ePLKRFaALCSGSFLIALALVFI--NSAGWLWIDKNSKKLGGLAMPWSYAVNTTLFYVHQY 202
gi 502452685 138 IKAQIvy------vTFKRFlVIALASLLFMLAVVFA--NSQNWLWVDKNSKVLGGLAMPWSYTVNLSLFFVHKQ 203
gi 505359046 139 FARRFdy------gSWKRFfARTGIALAVSLAIALV--NMQNWPWIDRNAPKLGSLVMPWSYTVNSVRYYNSVk 204
gi 501019434 158 IRASVqk------tSKIRLfAHLIITVIVTSTWIWQ--SQSHWLWIDDHAKQLGGRIMPWSYVGNTIRYQNQLA 223
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap