Conserved Protein Domain Family
TES

?
pfam08034: TES 
Trematode eggshell synthesis protein
This domain has been identified in a number of distantly related species of trematodes. This protein domain is crucial for eggshell synthesis in trematodes (Ebersberger I).
Statistics
?
PSSM-Id: 311818
View PSSM: pfam08034
Aligned: 12 rows
Threshold Bit Score: 50.763
Threshold Setting Gi: 350646285
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 350645358  92 EGLFFSRGYSIYGDIDSETTTFQYGGKITKYGkR-R-RKYSDRDTIGSSDRYASSYIKDDFRIRAK 155
gi 350645351  91 HGKMTGVGHQDYGVHYLSLTKFRKGGGYDIYG-K-K-RQFLDYDTQGHVKKYGNQHMKAKFEVVGN 153
gi 350011467 176 AGRFLGKGIETRGSKYETVTSFQKGGVYGPNG-Y-K-KRHHDYNTQGFVKNFLGKEIDSKFQLDGN 238
gi 358336696 161 KGNFYGTGTEGEGSQYEHVTTFRRGGGHDTKG-K-K-KHYNEYDSYGQAKKYGDKKVANNFDLRGi 223
gi 350646279 103 KGYQTFLGKRRRGSKSHVRTTFRRRSGYDYNG-R-K-ERSSTFESYGEADSFDRKKIRDVFDVNGy 165
gi 46403863  105 KGKFYGHGNEEQGSKFEQFTKFRRGGGHDSYG-K-K-KHYNDYDTYGQMKKYGNRDVSSKFEMYGK 167
gi 350646282  85 KGNFNRHGRGEYDSLSTRSSRFKVKGSYDKYG-R-RtFQYSKLKRGGKRKSYSKRFSFDNFNINGN 148
gi 350011466 106 RGKFHGTGYEDESSEYQTVTKFRRGGAQNGYG-K-K-KHYNQYDSYGQARKTGDKKVASKFDLFGK 168
gi 350646285  92 KGKFQSRGTRGYGMVSSESSQFLIEETLDKYG-RpK-PIKSKFKTRGKKKKYSKKIVDNQFDIKGG 155
gi 350646284  90 KGKFRSRGLGRHGIVSSESTYYVIEGKFDRYG-RkR-PTNSKFKTRGKEKKYSKKIVDNQFDIQGG 153
gi 350646283  98 NDQIQSRGNSAKGGSYSESTYFTLHSGTDRYG-R-R-NDYSRFQTRGRSNGYRENMFLNVFDVVGN 160
gi 350645355  66 QGKFIAYGNADKGLKYHQTTYFHKGSKY-------Q-KKFANYDTKGKVHSYGKQNVKAKFNIESK 123
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap