Conserved Protein Domain Family
Op_neuropeptide

?
pfam08035: Op_neuropeptide 
Opioids neuropeptide
This family corresponds to the conserved YGG motif that is found in a wide variety of opioid neuropeptides such as enkephalin.
Statistics
?
PSSM-Id: 311819
View PSSM: pfam08035
Aligned: 13 rows
Threshold Bit Score: 53.567
Threshold Setting Gi: 223344
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30
                 ....*....|....*....|....*....|
gi 82209437  190 YGGFMKSWDERAQKPLLTLFKNVMHKDQPR 219
gi 82079164  184 YGGLMRPYLDESHKPLITLIRNAIGNGQQF 213
gi 551506518 175 YGGFMKSWQEHSKRPLITLFRNVINKDGEE 204
gi 992217657 169 YGGFMKPWSEKSSKPFITLLRNIIVKDGQ- 197
gi 926659870 177 YGGFMRSWDERDPRPLLTLLKNVLNTEGRQ 206
gi 327286472 210 YGGFMTS--ERSRMPLVTLFKNAIVKTPYK 237
gi 311265381  99 YCGFMTS--KKSQMPLVMLFKNAIIKNTHK 126
gi 821459762 350 YGGFMVS--EKSHTPLMTLFRNAIIKNAPD 377
gi 923871939 164 YGGFMKSWDERSQRPLITLFKNVINKEAQE 193
gi 556997552 222 YGGFMRSWDERSQKPLMTLFKNVMIKDGHE 251
gi 223344      1 YGGFMSS--EKSQTPLVTLFKNAIIKNAHK 28
gi 733880519 219 YGGFMSL--EHSQTPLMTLFKNAIVKSAYK 246
gi 432848894 183 YGGFMKSWEEDRQKPLVTLFKNIINKDEQQ 212
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap