Conserved Protein Domain Family
NADH_oxidored

?
pfam08040: NADH_oxidored 
MNLL subunit
This family consists of the MNLL subunits of NADH-ubiquinone oxidoreductase complex. NADH-ubiquinone oxidoreductase is involved in the transfer of electrons from NADH to the electron transport chain. This oxidation of NADH is coupled to proton transfer across the membrane, generating a proton motive force that is utilized for the synthesis of ATP. MNLL subunit is one of the many subunits found in the complex and it contains a mitochondrial import sequence. However, the role of MNLL subunit is unclear.
Statistics
?
PSSM-Id: 311822
View PSSM: pfam08040
Aligned: 13 rows
Threshold Bit Score: 81.6948
Threshold Setting Gi: 118788550
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 82102153     1 MVNFAQAVRDHWVHILVPL-GFVVGCYLDRWNDEKLSAFRNKSVLYKrRELKPSEETTWK 59
gi 6093505      1 MVNLLQIVRDHWVHVLVPM-GFVIGCYLDRKSDERLTAFRNKSMLFK-RELQPSEEVTWK 58
gi 565311490   16 tMNIIHLVRDHWPLALCPL-GFLVGWYFDKQHDEKLATFRNKSKLYQ-RELKPGEDAIWK 73
gi 611970649    1 MMNLILAVRDHWVHILVPM-GFVVGYYLDKKSDEKLTAFRNKSMLFK-RNLKPNEEVTWK 58
gi 1032913103   5 imTLLQLVRDHWVHILVPM-GFAFGYYLDKRADEKLTTFRNKSMLFR-RELRPNEEVTWK 62
gi 965828889   43 MMNLLQVVRDHWIHVLVPV-GFVFGYYLDRKNDEKLAAFRNKSLLYK-RELKPNEEVTWK 100
gi 817276899    1 MVNFLQLVRDQWVVLFVPM-GFVLGCYLDRKNDEKLTAFRNKSMLYK-RELRPNEEYTWK 58
gi 972980668   17 MVNLVNMLREHWVNVLVPL-GFVIGIYMDRRNDEKLTAFRNKSMLYK-RELKPGE-VTWK 73
gi 597784045    1 MVNFALLVREHWVNVLVPL-GFVVGVYLDRWNDQKLTAFRNKSALYS-RELKPGEEYTWK 58
gi 620955059   30 MVNFVQIVCDHWVHVLVPM-GFVIGWYLDKRSDEKLTAFANKSKLFG-RELKsdedtrk- 86
gi 974056392   41 MVRFALPTSVNWAHILVPM-GFVIGWYLDKQQDKKLTAFRNKSALYS-RELKPGEEVTWR 98
gi 543890890    1 MVNFVALAREHWVNILVPM-GFVFGWYLDKQQDQKLTAFRNKSALFS-RELKPGEEVTWK 58
gi 118788550    1 MFGL----NRQYLWSVVPLfGFGVGWFLDRKETERMTMFRDKSALYG-RTLKEGEKPSWP 55
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap