Conserved Protein Domain Family
DUF1707

?
pfam08044: DUF1707 
Domain of unknown function (DUF1707)
This domain is found in a variety of Actinomycetales proteins. All of the proteins containing this domain are hypothetical and probably membrane bound or associated. Currently, it is unclear to the function of this domain.
Statistics
?
PSSM-Id: 311825
View PSSM: pfam08044
Aligned: 328 rows
Threshold Bit Score: 31.9794
Threshold Setting Gi: 0
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|..
gi 81413514     11 LRVSDADRNGIMRRLHNAVALGLIDIDEFEQRSSQVSYARTRGELDDLVGDL 62
247_pfamImport   1 -RVYNADRKQALRHLDQAIADGRLDIQDYEEFSGVIARTEDMGELEDVVR-- 49
143_pfamImport   1 LRIGTAERESAAKALDAHLEAGRLGVEEYADRSAAAAVATVASELQALFVDL 52
216_pfamImport   1 IRVGDADRETAARLLHLAVEEGRLDLPELDRRLVLVYSAQTSTDLAAVTSDL 52
98_pfamImport    1 LRIGDSDRELVSRLLKQAVDEGRLTLPEYDLRLQQVYEAKTVGDLDPITGDL 52
86_pfamImport    1 -RFTEADRDKIAGRLRDAFADGRLDQPEFTARLDRLYGAQTYGELEPLVRDL 51
118_pfamImport   1 --VADAQRDDLTQRLNTAYERGDLSLEDYQGLLAQLFEAHTTGDLVPVVQAL 50
225_pfamImport   1 --VTDADRADLNTWLNDAYSDGKIDESTFREGLDTVYSAATLGDLVPVVAGL 50
204_pfamImport   1 --VGETEREALSKRVSDAFADGRMESDSYRQSMDVIYGAKTLGDLVPVVEQL 50
gi 644675304     1 MRIGESERQQAREALDRHLADGRLSAEEYGDRSVAVMVATTEEDLAPVFVDL 52
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap