2APO


Conserved Protein Domain Family
DKCLD

?
pfam08068: DKCLD 
Click on image for an interactive view with Cn3D
DKCLD (NUC011) domain
This is a TruB_N/PUA domain associated N-terminal domain of Dyskerin-like proteins.
Statistics
?
PSSM-Id: 336916
View PSSM: pfam08068
Aligned: 52 rows
Threshold Bit Score: 81.021
Threshold Setting Gi: 504398918
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*....
2APO_A        35 DKEELIVKEE-VETNWDYGCNPYERKIEDLIKYGVVVVDKPRGPTSHEV 82
gi 37089078   13 RDREMITKAE-VETDPRYGCPPEERPIEEYIMKGVINLDKPAGPTSHEV 60
gi 42559714   27 EKYEIWVKKE-AETNEKWGEDPYNRPIERLLKYSVINLDKPSGPTSHQV 74
gi 3915195    14 DKEELIVKEE-VETNWDYGCNPYERKIEDLIKYGVVVVDKPRGPTSHEV 61
gi 402467120  16 DIDKMHVKTL-HHTPLKTGFEPLKRPLLEHLKYGVVFIDKVKGPSSHEI 63
gi 667641440  10 NQDQMVVKSR-DHNPSGHGTMPVNRPIGEYLKYGVVTVDKPANPSSHEV 57
gi 523780865  11 NLENMAIKTE-SFNVQSRGNIPELRPIDEYLKYGVITLDKPQNPSSHEV 58
gi 490170120  15 IKREIVIKDEkAETNPKWGFPPDKRPIEMHMQFGVINLDKPPGPTSHEV 63
gi 502802804  16 RQREYILKGD-AHTDPSYGCPPHKRPLSFYMRMGVVNLDKPAGPTSHEV 63
gi 378755245  46 GLEDMNIKSL-KYTPTSYGYSPLERPLNIYLEYGVINLDKPCNPSSHEI 93
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap