Conserved Protein Domain Family
Ribosomal_S13_N

?
pfam08069: Ribosomal_S13_N 
Click on image for an interactive view with Cn3D
Ribosomal S13/S15 N-terminal domain
This domain is found at the N-terminus of ribosomal S13 and S15 proteins. This domain is also identified as NUC021.
Statistics
?
PSSM-Id: 311836
View PSSM: pfam08069
Aligned: 123 rows
Threshold Bit Score: 66.7088
Threshold Setting Gi: 383796160
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*...
3J7A_U         4 MYGKGKGISSSTLPYKRKQPSWL-KQKPSEIEDAIIKLAKKGQTPSQIGATLRDNYGI 60
gi 51702026    4 MHSSGKGRSGSVKPYATAFPTWL-TKSVDEIKSDVIQMGNKGVPAPDIGTRLRDEYGI 60
gi 523781167   4 MYSNGKGQSKSVTPYNLTYPTYI-KHSKEEIVDVILNLARKGTPPSQIGNILRDNYGV 60
gi 255098791   4 MHSNGRGISSSVKPYTTMFPTWL-DTPLEEIKQDIIRMANKGFRTAEIGNKLRDVYGV 60
gi 667642320   4 MHTAGKGQSISMKPLSTTVPTFM-TKPIYEIKKDIIQHANKGMVPSAIGNLLRDQYGV 60
gi 300707735   4 MHSSGRGISTSIKPFTVMFPTWL-DVPVEEIKADVLKMNTKGVSSAEIGNKLRDVYGV 60
gi 402468209   4 LYTSKRGKSGSLKPYTLHTNEPVvRLSKQEIVDFIVQNAKKGMPPAKIGTLLRDLHAV 61
gi 315425812   4 MHASKRGKSGSTRPLSKIPPPWL-KLMPEEVESLVIKYAKEGMPPSMIGVVLRDQHGV 60
gi 505045014   2 hkNSRRGKSHSIRP-STFTANWI-TYSQQEVEMIIEELAKKGYTPSQIGLVLRDQFGI 57
gi 503032043   2 hkKSRKGQSHSTRPAHPRPPSWL-SLTPDEIETIIEQLAQKGYTPSQIGLILRDQFGV 58
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap