Conserved Protein Domain Family
RS4NT

?
pfam08071: RS4NT 
Click on image for an interactive view with Cn3D
RS4NT (NUC023) domain
This is the N-terminal domain of Ribosomal S4 / S4e proteins. This domain is associated with S4 and KOW domains.
Statistics
?
PSSM-Id: 311838
View PSSM: pfam08071
Aligned: 53 rows
Threshold Bit Score: 54.8721
Threshold Setting Gi: 160339607
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30
                 ....*....|....*....|....*....|....*..
3J7A_F         3 KGIKKHLKRVNAPSHWMLNKMGGQYAPKTSSGPHKLL 39
gi 189045354   4 MGSRKHLKTYKAPKTWPIHPKEDTWTVKPSAGSHSIE 40
gi 121729294   4 MGSRKHLKRFKAPKMWPIHKKEEVWTTKTSAGPHALE 40
gi 503179280   4 MGSRRHLKRLKSPRHWPIPRKEKKWTVKPSPGPHSAD 40
gi 383795415   4 MGGSKHLRSYSAPDFWPISTKERFWAIKPSPGPHSLs 40
gi 505045883   4 MGGTRSIKGIAAPPFWPIERKLRPWTPKPSPGPHNAE 40
gi 503031169   4 MGGSRHLKALSAPSVQRIPRKVRPWTVKPSPGPHPAD 40
gi 160339607   4 isGSKKLKRQMAPQFWGIARKDKRFVITTRPGPHKKH 40
gi 503591897   4 MGSRKHLKRFKSPEHWPIHPKENKWTVKPSAGPHSIE 40
gi 500075905   6 KGSLRHLRRSVAPPFWPIKRKEYVWTVKPSPGPHSLl 42
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap