Conserved Protein Domain Family
BDHCT

?
pfam08072: BDHCT 
BDHCT (NUC031) domain
This is a C-terminal domain in Bloom's syndrome DEAD helicase subfamily.
Statistics
?
PSSM-Id: 311839
View PSSM: pfam08072
Aligned: 16 rows
Threshold Bit Score: 70.3479
Threshold Setting Gi: 972963526
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|
gi 17366086     79 LYSVMEDICKLVDAIPLHELTSISCAKELLQQRELRRKLL 118
gi 620962800   397 LLRVMEEMCEMVDAIPICELQALRCGNELLRKREHRKRLL 436
gi 556989705   421 LYRVMEEICRLVDTIPLDELKALSCGSQLLQQRQHRRAIi 460
gi 637269407   379 LYSVMEDICKLVDSIPERDLRFLSCGSELIRHRDYRRQLL 418
gi 655884803   375 LLQVMEHICVLVDAIPAEALRALEGGSELLRQRDTRRKLL 414
gi 565318111   302 LLCVMEDICKLVDSIPERELKCLLGGQELLRLRDCRRKLL 341
gi 808867571   341 LFSIMESICALVDSVPEHELIALSCGNELLVKRAQRKRIL 380
gi 1040669384  379 LFSVMESICCLVDTIPEHELIALTCGTELLLQRAHRKRIL 418
gi 676409036    81 LYGVMEAICELVDAIPLQELQALGCARALLQHRDLRRKLL 120
gi 672013909   371 LIRVMEHICKLVDTVPIDELKALTCGDKLLQQRDIRRKLL 410
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap