Conserved Protein Domain Family
CHDNT

?
pfam08073: CHDNT 
Click on image for an interactive view with Cn3D
CHDNT (NUC034) domain
The CHDNT domain is found in PHD/RING finger and chromo domain-associated helicases.
Statistics
?
PSSM-Id: 311840
View PSSM: pfam08073
Aligned: 22 rows
Threshold Bit Score: 79.6376
Threshold Setting Gi: 341890749
Created: 23-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....
2N5N_A         25 DHVFSEEDYRTLTNYKAFSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNP 78
gi 403399446   95 EFDYDEEEFQGISNLKTFSSIIKPQILEANPGTNVSKMYPMFQVKYKEYQDHMa 148
gi 6165993     97 DVDYEQEEFQSITNLKNFSSLVKPYILKVNPGTNVTKMYPLFQVKYKEFQDHMT 150
gi 780089050  127 EMEYTESDYDELINYKLYTDNIRPLVLENAPKLHSQKLVNLLAALWKEFAANNP 180
gi 541044064   95 PLDFTEEDYNTVTTAKTFAARVRPLLQAANPKALSVKIQQVISAKYREYQEEMa 148
gi 393911013    8 PNNFTEEDINSITSAKAFALRVRPQLQAANPKALFTKLQQLVQAKYREFQEEMa 61
gi 341890749   80 vLDYDGHLFHGISGIKSFQALIRPVVLHHNPGAVHAKILRLIQEKFEEFQNHMa 133
gi 927195868   24 DHVFTEEDYHTLTNYKAFSQFMRPLIAKKNPKIPMSKMMTIMGAKWREFSANNP 77
gi 353229870   80 EMTYSTEDFENWTIQKLFDQYVRPLIANKNPNASKEDVQKVLDAKWKEFAIMNP 133
gi 699245096  133 EHEHDEQDYSTLTTYRLFSQHIKPMLARVYPRLPISRTLTIVAAMWREFSNspk 186
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap