2N5N


Conserved Protein Domain Family
CHDNT

?
pfam08073: CHDNT 
Click on image for an interactive view with Cn3D
CHDNT (NUC034) domain
The CHDNT domain is found in PHD/RING finger and chromo domain-associated helicases.
Statistics
?
PSSM-Id: 336917
View PSSM: pfam08073
Aligned: 22 rows
Threshold Bit Score: 80.034
Threshold Setting Gi: 341890749
Created: 28-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....
2N5N_A          25 DHVFSEEDYRTLTNYKAFSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNP 78
gi 403399446    95 EFDYDEEEFQGISNLKTFSSIIKPQILEANPGTNVSKMYPMFQVKYKEYQDHMa 148
gi 6165993      97 DVDYEQEEFQSITNLKNFSSLVKPYILKVNPGTNVTKMYPLFQVKYKEFQDHMT 150
gi 1084291623   80 EMTYSTEDFENWTIQKLFDQYVRPLIANKNPNASKEDVQKVLDAKWKEFAIMNP 133
gi 780089050   127 EMEYTESDYDELINYKLYTDNIRPLVLENAPKLHSQKLVNLLAALWKEFAANNP 180
gi 699245096   133 EHEHDEQDYSTLTTYRLFSQHIKPMLARVYPRLPISRTLTIVAAMWREFSNSpk 186
gi 541044064    95 PLDFTEEDYNTVTTAKTFAARVRPLLQAANPKALSVKIQQVISAKYREYQEEMa 148
gi 1158592233    8 PNNFTEEDINSITSAKAFALRVRPQLQAANPKALFTKLQQLVQAKYREFQEEMa 61
gi 341890749    80 vLDYDGHLFHGISGIKSFQALIRPVVLHHNPGAVHAKILRLIQEKFEEFQNHMa 133
gi 927195868    24 DHVFTEEDYHTLTNYKAFSQFMRPLIAKKNPKIPMSKMMTIMGAKWREFSANNP 77
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap