Conserved Protein Domain Family
CHDCT2

?
pfam08074: CHDCT2 
CHDCT2 (NUC038) domain
The CHDCT2 C-terminal domain is found in PHD/RING finger and chromo domain-associated CHD-like helicases.
Statistics
?
PSSM-Id: 311841
View PSSM: pfam08074
Aligned: 14 rows
Threshold Bit Score: 233.026
Threshold Setting Gi: 802749514
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6165993   1511 EYEIWHRRHDFWLLAAVAVYGYGR----YQinfqDIMNDPKFSIVNEPFKQTGADpATnFADVKNKFLARRFKLLEQSLV 1586
gi 313247391 1268 INEIWHRRHDYWLLAGMATHGYAR----WV----DIQNDPKFSIINEPFRAMSQKqGN-FQDMQNRFLGRRFKLLEQALV 1338
gi 699245096 1628 LNEIWHRKHDYWLIAGIAIHGYAR----WS----DIQNDVRFAIVNEPFRAMHEK-GN-FLEMQNKFLARRYKLLEQALV 1697
gi 829899413  100 IYDIWHRRHDYWLLAGIVTHGYAR----WQ----DIQNDPRYMILNEPFKSEIHK-GN-YLEMKNKFLARRFKLLEQALV 169
gi 802749514  110 ENDIWHRRHDYWLLAGVVLYGYGR----YQ----DvlADPRYAILGEPFKTDAGK-GA-FLEQKNKFLQRRFKLIEQSLI 179
gi 308501284 1542 EYEIWYRRHDYWLLAGVVVHGYGR----FQanfnEIINDPRFAILNEPFKEAGADpAV--SDIKSKFMQRRFKLLEQGLV 1615
gi 341890749 1455 HYEVWNRLHDFWLLFGTATHGYSRssvsWQ----DVCNDPRCTIINEAFNRISDVeNKtYPDIKARFIQQRLKLLEQSLV 1530
gi 761913541 1054 dptkWGRHHDYWLLKGIVKHGYCR----WS----EICADPHLSILNKPFTPEENA-----SDAKNRFLLRRFKLLEQALA 1120
gi 353229870 1757 EAEIWHRRHDYWLLAGVVQHGYGR----WQ----DIHNDPHYAIVNEPFKNETQK-AN-FLEIKNRFLARRFKLLEQALI 1826
gi 20988518    29 LNEIWHRRHDYWLLAGIVLHGYAR----WQ----DIQNDAQFAIINEPFKTEANK-GN-FLEMKNKFLARRFKLLEQALV 98
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6165993   1587 IEEQLRRAAHINK--QQSPDQVGQLAQHFSELEHTADAHVNIARESNN-GNRNANAILHKCLAQLDDLLSDLKTDVARLP 1663
gi 313247391 1339 IEEQLRRASFLNLh-QDTKHSAMSLSNHFGQLETLAETHRLLPKIASD-GNKAAAHVLLKVLEQMETLLSEMKNDVHRLP 1416
gi 699245096 1698 IEEQLRRASYLGLv-QDTKHPAMSLNARFAEVECLAESHQHLSKESLA-GNKPANAVLHKVLNQLEELLADMKADVGRLP 1775
gi 829899413  170 IEEQLRRAAYLNMt-QDPNHPAMALNARLAEVECLAESHQHLSKESLA-GNKPANAVLHKVLNQLEELLSDMKADVTRLP 247
gi 802749514  180 IEEQLRRASHLNLshHTPAEGTTQFADRFAEMENLTASHTQVFKDGTAgGNRNANVVLQKV------------------- 240
gi 308501284 1616 IEEQLRRAAHANR--HLTPDNVGPLAQRFADLENIAESQANIAKESAA-GNRNANAVLHKCLVQLDEILSDMKADVSRLP 1692
gi 341890749 1531 IEEQLRRAAFLNM--QNHPENIGNLAHNYATLEFVADAGAYLSAESRN-GDRNANVVLHKALDTISTLLDNMRTDIQHLP 1607
gi 761913541 1121 IEEQLHRASSAGLv-QDPNKSVMLLHSRFTDLDCLADGHQSLVKDCLN-GSKYNVLLMRKALGKMEEILLEMKQDISKLS 1198
gi 353229870 1827 IEEQLRRAALLNIa-ADQSEHIQSLNRRFTELECLATGQLHLFNDALA-GNKALVPLLHKVLTLMEDILVDMKQDVARLV 1904
gi 20988518    99 IEEQLRRAAYLNLs-QEPAHPAMALHARFAEAECLAESHQHLSKESLA-GNKPANAVLHKVLNQLEELLSDMKADVTRLP 176
                         170       180
                  ....*....|....*....|....
gi 6165993   1664 ATISQVRPVTERLQMSERQILSRL 1687
gi 313247391 1417 GELSRVQAVSGRLGMSERALLERL 1440
gi 699245096 1776 ATLSRIPSVASRLRMSERGILSRL 1799
gi 829899413  248 SMLSRIPPVAARLQMSERSILSRL 271
gi 802749514      ------------------------
gi 308501284 1693 ATFTQLSSVTERLNMTERQILSRL 1716
gi 341890749 1608 TIVNKIRPVTDRLQMSEERILSRL 1631
gi 761913541 1199 MELTKCSSVSQQLKIDELSILSKL 1222
gi 353229870 1905 NLLPRLPPVTQRLQLSHTGLLGKL 1928
gi 20988518   177 ATLSRIPPIAARLQMSERSILSRL 200
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap