4A17,3J3B,3IZS,3J39,3ZF7


Conserved Protein Domain Family
Ribosomal_L30_N

?
pfam08079: Ribosomal_L30_N 
Click on image for an interactive view with Cn3D
Ribosomal L30 N-terminal domain
This presumed domain is found at the N-terminus of Ribosomal L30 proteins and has been termed RL30NT or NUC018.
Statistics
?
PSSM-Id: 336919
View PSSM: pfam08079
Aligned: 163 rows
Threshold Bit Score: 31.7656
Threshold Setting Gi: 74992365
Created: 29-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
4A17_V          5 VPENVQKKLA--RDEKLRKAKAEQRKASSAQMKQRKAEWISKAQKYAAEYEAAEKKIVDEKRKARKTGAFYVPA 76
gi 121959267   28 VPESKLKATK--VKTIARPGSLHRRRHLLAVKLVRQKQNLLRAAKYAKKYIRMDRDVVEKARAAKKAGNIYIPA 99
gi 1084314049  19 kPEGLRVKEK--IRRRKLITVARKKVIRRQTYMKLKSLMKQRAEKYMHEYRRMAKREMTLQRNAKKTGDFYVPA 90
gi 125985071   17 VPESKLKFSK--KQISKRAAESKRRLKRAAVIALRKKENLVRAEKYQNEYIKSDQREIKLRRLAKKRNQFYVPA 88
gi 674570837   98 kpeklkyKQM--IRARRIKSEAKKKVIKRLKYLRLKKIYIKHAQKHLIEYRRAAKREINLMRSAQKAGNFYVPA 169
gi 330791822   12 VPESILKKRA--TSQKKAVDVAKLGRAQQLKNSRLNSIYFKRAEKYVAEYHKTEREAIRLNRIAKNSGTFYVPP 83
gi 1160575133  57 VPESILKKRA--TTQKKAIDQVKVQRALKLRNSRLRSKYFQRAEKYVREYRMAEREQIRLQRVAKNTGVFYVPP 128
gi 514693697    9 VPAMHLKKKA--RNQRIAKTLRAKKAAETKRRLKNRREIIKRAAKYEKEYEHNERTAMRLNRIAKKTGTFYIPE 80
gi 749159095   15 APQNELQKKKlaRDQKHFAEKQAAVAAKAKAQEELLVEMQGKLAKYEAEYAAQQEEESRLKAEAKANGGFYKPA 88
3J39_F         17 VPESKLKFSK--KQISKRVAESKRRLKKAAVIALRKKENLVRAEKYQNEYIKAEQREIKLRRLAKKRNQFYVPA 88
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap