Conserved Protein Domain Family
Ribosomal_L30_N

?
pfam08079: Ribosomal_L30_N 
Click on image for an interactive view with Cn3D
Ribosomal L30 N-terminal domain
This presumed domain is found at the N-terminus of Ribosomal L30 proteins and has been termed RL30NT or NUC018.
Statistics
?
PSSM-Id: 311843
View PSSM: pfam08079
Aligned: 168 rows
Threshold Bit Score: 29.8243
Threshold Setting Gi: 74992365
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
3J3B_F          14 VPETLKKKRRNFAELKIKRLRKKFAQKML-RKARRKLIYEKAKHYHKEYRQMYRTEIRMARMARKAGNFYVPA 85
83_pfamImport    1 VPENLLKKRKAYQALKATQAKQALLEKRK-QKKGTQLKFRRLESFVHESHRVSRDVARLKRLVSKPGCYVLKD 72
144_pfamImport   1 VPENILKKRKVYQAIKATQAKQALLDKRK-HQSGKQIRFKRLEVFLRDSQRKHRDDVRLRRMEHKPGQMIMPD 72
60_pfamImport    1 VPENLLKRRKAYQAIKAAQAKQALLNKRK-LQKGKQIQFKRLETFVRDSWRKRRDDVRLRRMEQRPGQVAVPE 72
75_pfamImport    1 SAKVILRLRDRNSGDKIKGERRGRKEKRK-VQKGKQIQFKRLETFVRDSWRKRRDDVRLRRMEQRPGQVAVSK 72
96_pfamImport    1 VPENLLKRRKTYQAIKATQAKQALQDKRK-VQRGKQISFKRVETFIRDSRRKHRDEVRLARMAKKPGDVCIPE 72
134_pfamImport   1 EPEVILKKRKVNEKTRLERVEAALAKKEA-QKNKKKIIFKRAESFIKDFRDGEKERLRLKRVAKKDGNAFVDE 72
113_pfamImport   1 VKETVLKKRKENADWAVRNRERKAAKRQR-IRAENKVVVKRPEEFVTAFRNKERDFLRMRTRLKVRKQPSVEA 72
103_pfamImport   1 VRETVLKKRKVNEDWAVKNRERKAAKRQR-RRDDGKGAIKRPEDFVREFRNKELDFVRMKTRLKVRKLPPAET 72
135_pfamImport   1 VPEVILKKKKKNEISKAKSVANEIKNKTKkESILKRIRFKRAEKFVKEYRSRENFDIQIQRRARRANLYKIPV 73
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap