Conserved Protein Domain Family
zf-RNPHF

?
pfam08080: zf-RNPHF 
RNPHF zinc finger
This domain is a putative zinc-binding domain (CHHC motif) in RNP H and F. The domain is often associated with pfam00076.
Statistics
?
PSSM-Id: 311844
View PSSM: pfam08080
Aligned: 3 rows
Threshold Bit Score: 75.3464
Threshold Setting Gi: 676280041
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30
                 ....*....|....*....|....*....|....*.
gi 676280041 471 FTTDLFGRDLSYCLSGMYDHRYGDGEFTVQSTTGHC 506
gi 927104940 292 FGSDRFGRDLNYCFSGMSDHRYGDGGSTFQSTTGHC 327
gi 944206572 301 FGSDRFGREWTLFSAGMSDHRYGDGTSTFQSTTGHC 336
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap