Conserved Protein Domain Family
Toxin_17

?
pfam08086: Toxin_17 
Click on image for an interactive view with Cn3D
Ergtoxin family
This family consists of ergtoxin peptides which are toxins secreted by the scorpions. The ergtoxins are capable of blocking the function of K+ channels. More than 100 ergtoxins have been found from scorpion venoms and they have been classified into three subfamilies according to their primary structures.
Statistics
?
PSSM-Id: 116691
View PSSM: pfam08086
Aligned: 5 rows
Threshold Bit Score: 52.2085
Threshold Setting Gi: 38258442
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40
               ....*....|....*....|....*....|....*....|.
1NE5_A       1 DRDSCVDKSRCAKYGYYQECQDCCKNAGHNGGTCMFFKCKC 41
gi 38258460  1 DRDSCVDKSKCGKYGYYQECQDCCKNAGHNGGTCVYYKCKC 41
gi 38258445  1 DRDSCVDKSRCAKYGYYGQCEVCCKKAGHNGGTCMFFKCMC 41
gi 38258454  1 DRDSCVDKSRCQKYGPYGQCTDCCKKAGHTGGTCIYFKCKC 41
gi 38258442  1 DRDSCVDKSKCAKYGYYYQCDECCKKAGDRAGTCEYFKCKC 41
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap