Conserved Protein Domain Family
Antimicrobial10

?
pfam08105: Antimicrobial10 
Metchnikowin family
This family consists of the metchnikowin family of antimicrobial peptides from Drosophila. metchnikowin is a proline-rich peptide whose expression is immune-inducible. Induction of the metchnikowin gene expression can be mediated either by the TOLL pathway or by the imd gene product. The metchnikowin peptide is unique among the Drosophila antimicrobial peptides in that it is active against both bacteria and fungi.
Statistics
?
PSSM-Id: 311854
View PSSM: pfam08105
Aligned: 2 rows
Threshold Bit Score: 56.1214
Threshold Setting Gi: 195028189
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|
gi 195028189  1 MQLNPSKLMPLLLPLLLLLGVAFSEASRRQGPIFDTRPSPFNPNPPRGGP 50
gi 17737475   1 MQLNLGAIFLALLGVMATATSVLAEPHRHQGPIFDTRPSPFNPNQPRPGP 50
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap