Conserved Protein Domain Family
MDM31_MDM32

?
pfam08118: MDM31_MDM32 
Yeast mitochondrial distribution and morphology (MDM) proteins
Proteins in this family are yeast mitochondrial inner membrane proteins MDM31 and MDM32. These proteins are required for the maintenance of mitochondrial morphology, and the stability of mitochondrial DNA.
Statistics
?
PSSM-Id: 311856
View PSSM: pfam08118
Aligned: 72 rows
Threshold Bit Score: 519.4
Threshold Setting Gi: 74591128
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74607484    96 RDRLLAQATNILQRLKINLKWTLTRSMRPFNTDDISAFVSWVLVSNMLLIFLFTTSFLSLAIYLMNTVFAQEYLATKVGN 175
32_pfamImport   1 KDEMLALANGFWERLRIRFKWFTIRGFRKFNTDDMSAFLSWIVFGQAVWILLGTTTFFSVVFATFNSLRMQEFVARKISD 80
63_pfamImport   1 RDDFLRLADGFWQGLRIRFKWFTIRSFRKFNADDISGIVTWILMSQTIWILIGTTTFFSVVFAIANSLRLQNFIARGISD 80
45_pfamImport   1 RDEFLSVATGFWQRLNIRFKWFTIKSFRKFNADDISAFVTWFLMSQTLWIFVGTTTFFSVIFAVANSLRLQHYIARAISD 80
4_pfamImport    1 REDFLNVATSFWQRLRIRFKWFTIKSFRKFNADDISAFITWFLMSQTLWILVGTTTFFSVIFAIANSLQLQHYIARAISD 80
22_pfamImport   1 RDDFLRVATGFWQRLRIRFKWFTIRSFRRFNADDISAFITWFLMSQTLWILVGTTTFFSVVFATANSLRLQENVARAISN 80
44_pfamImport   1 RDDFLNAASGFWQRMRVRFKWLTIRSFRKYNADEISAFITWFFMSQTLWLFVGTTTFFSVFLITVNSLRLQENVARAISD 80
48_pfamImport   1 RDDFLKAANGFWQRARVRFKWLTIRSFRKYNADEISAFITWFLMSQTLWLFVGTTTFFSVLFATANSLRLQEYVARAISD 80
60_pfamImport   1 REDFLNAANGFWQRARVRFRWLTIRSFRKYNADDISAFVTWFVMSQTLWLFIGTTTFFSVIFATINSLRLQEYVARAISD 80
gi 302681701   12 REAMLNAASGFWERLRIHWRWMALRSFRKFNADDFSAFLTWFVMSQTIWILVGTTSFLSAVFWLANSLSLQHYIAKALSD 91
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74607484   176 FLTKNSALSVVFESAIVPDWSSGKISFNRVFVSRR-PK-----LPHGFSKGSQHEAVErAKLAL---SERLLvs------ 240
32_pfamImport  81 YLTRETGWTVVFESAIVPKWKDGKISFKKTYISRH-PDltshlSQDA----PKSPDSAsHPAHTaatRLDVhhpti-hhs 154
63_pfamImport  81 YLTSETGVTVIFESAIVPKWKDSRISFKNVYISRR-PV-------------SMQTQQKkLKEHQsalGYDVAhhpayhhi 146
45_pfamImport  81 YLTSETGVIIIFESAIVPKWRESRISFKNVYVSRRlPEt------------AARKIQRkRSEHLtaaGYDVSnhpgyhql 148
4_pfamImport   81 YLTSETGVTIIFESAIVPKWKDSRISFKNVYVSRR-PAdsdigSP------LGTPPNEeRSRNMagvGYDVGnhpayhrv 153
22_pfamImport  81 YLTAETGVTIIFESAIVPKWKDSRISFKNVYISRR-PRs-----------dVTPSTEKkVTGHKaaiGYDVSghpayhyt 148
44_pfamImport  81 YLTAETGIHIVFESAIVPKWKDSRISFKNVYITRR-PDv------------VNKVRADrNTGYHyatGYDVSnhpanhgf 147
48_pfamImport  81 YLTSETGITIIFESAIVPKWKDSHISFKNVFVSRR-PLdl---------etVRQRRSLrNAGYKaavGYDVSnhpsnhsl 150
60_pfamImport  81 YLTSETGITIIFESAIVPKWKDSRISFKNVYVIRG-PKgpe--------maRARSDAMfHAGHKvavGYDVSnhpsfhsi 151
gi 302681701   92 YLTRGTDIMIVFESAIVPKWRDSKLCFKNVYISRG-PHtteqeKKRQDEKRAQSDGEEgEPGHPp--QMAGKvp------ 162
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74607484   241 -rEDf------------------DDGNYTQFDLTMDQVEISVSLSKWINGKGFLDEVTINGLRGVVDRTHVFWKEn--DD 299
32_pfamImport 155 geDDiehfvaprtleiesideltPDQRITTFDLEVDSVDVELSLSRWLDGKGLVQNATIKGVRGVVDRRLISMDTd-dLD 233
63_pfamImport 147 edDDdelp-----------fppeEECNYSMFDLNIGSIDVTLSLWRWLDGKGLIESAAVKGVRGVLDRRSVRYDPdhpLD 215
45_pfamImport 149 neDDdedavp--------ieldkQDTNMSLFDLNIDSVDVTLSLWRWLDGKGLVEDAVVKGVRGVLDRTNVYWDPdnpLD 220
4_pfamImport  154 geEDednadg-------frpledEDYNYTMFDLTIDSVDVTLSLWRWLDGKGLVEDAVIKGVRGVVDRRNVFWDPdnpLD 226
22_pfamImport 149 gdEEeeitl----------dhsdDDLNYSMFDLNVDSIDVTLSFKRWLDGKGLVEDAVIKGVRGILDRRSVFWDPehpLD 218
44_pfamImport 148 myDEedsil---------eelpgEDTNYSMFDLSVDTIDVTLSFTRWLEGKGLVTDAVVKGVRGVLDRRFVHWDPenpLD 218
48_pfamImport 151 aeEDddmml---------edhsnDDVNYSMFDLSVDSIDVTLSFTRWWQGKGLVTDAVIKGVRGVLDRRSVTWDPdhpLD 221
60_pfamImport 152 geEEdddgp---------naphdEDLNYTMFDLTVDSIDVTLSFARWWQGKGLVVDAVVKGVRGVLDRRNVFWDPdhpLD 222
gi 302681701  163 -eQLle------------------eYNYTMFDLNVDSVDVTLSLWRWLDGKGLVKDAVVKGVRGAIDRRSIHWDPenpLN 223
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74607484   300 ARNYLNVHQPGDFEISKFVMNDVLFTLYQPGGFRPFLVSVFNCELPQLRKHWLFFDFLNADNISGAYDNSMFTIHKKFKQ 379
32_pfamImport 234 PASFRH-PNPG-FELESLQLEDVLVTVYQP-NFRPYMASIFQADFRLLRKQWLFYDLLSAKSIVGQFDNCLFSLHEPQSI 310
63_pfamImport 216 PALFRHESHPGDFELESLQLEDVLITVHQPGGFRPYTASIFRADIRTFRKRWLFYDFLCAENIVGQFDNCLFSLHKPQSI 295
45_pfamImport 221 PALFRHKFVPGDFELESMQLEDLLITVYQPGSFRPFTASIFRADIQQFRKRWLFYDFLCAENVVGQFDNCLFSLHTPQSI 300
4_pfamImport  227 PAAFRHKYQPGDFELERLQLEDVLVTVYQPGEFRPYTASIFRADIRTFRKRWLFYDFLAAENVVGQFDNCLFSLHKPQSI 306
22_pfamImport 219 PAAFRHTPQPGDFELELLQLEDVLITVYQPGDFRPYTASIFRADMRNLRKQWLFYDFLCAENVVGQFDNCLFSLHKPQSI 298
44_pfamImport 219 PASFRHQARQGDFELESFQLEDLLVTVYQPGSFRPFTASIFRADIRTFRKQWLFYDFLSAENVVGQFDNCLFSLHKPQSI 298
48_pfamImport 222 PAAFRHIAQPGDFELESLRLEDVLITVYQPGGFRPYTASIFRADIRTFRKQWLFYDFLRAENVVGQFDNCLFSLHRPQSI 301
60_pfamImport 223 PVLFRHESQPGDFELESLQIEDLLLTVYQPGGFRPFTASIFRADMRTFRKQWPFYDFLAAENVVGQYDNCLFSLHRPQSI 302
gi 302681701  224 PADFRHKSQPGDFELESLQMEDVLVTVYQPDAFRPYTASIFRADFPIFRKQWLFYDFLSADSIVGQFDNCLFSLHKPQSI 303
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74607484   380 RDTDEESSSssPWHKVTRMRVDNLNIDHLN---A--GIEGPFGWITSGHVDMIGDLLLPE-NDiDPsQLSEILTVVRDRI 453
32_pfamImport 311 GRTMAEDLKdtQWKRMSRFRIDGVNIDHLQaatG--SSAGPISWITSGKVDAVLDIKFPR-DAsGEvDISSLINEIAHNI 387
63_pfamImport 296 GRTTEMDLQdgEWARMSRIRIDGVNIDHLQa-sT--TMEGPVSWITSGKLDAVFDIKFPQ-DP-GDgTLSAILEEITDAI 370
45_pfamImport 301 GRTTEKDLEdgEWARMSRLRIDGVNIDHLQnstT--TMEGPISWITSGKVDAVLDIKFPR-DPnGDlHLNAILGEIADAI 377
4_pfamImport  307 GRTTEKDLEhgDWGMMTRIRIDGVNIDHLQn-sT--TMEGPISWITSGKVDAVLDIKFPR-DPqDGlALNAILEEIADAI 382
22_pfamImport 299 GRTTDQDLKdgKWSRMSRIRIDGVNIDHMQn-sT--TQEGPISWITSGKVDAVLDIKFPR-DPeDDfPLNALLGEIADAL 374
44_pfamImport 299 GRTTEQDLKdgQWARMSRLRIDGVNIDHLQh-mS--TQEGPISWITSGKVDAVLDIKFPR-DYsDDsPFNTLIGEIADAI 374
48_pfamImport 302 GRTTDQDLKdgQWARMSRFRMDGLNVDHLQa-mT--TQEGPISWITSGKVDAVLDIKFPReDPeEG--FEALLGELADAI 376
60_pfamImport 303 GRTTEQDLQdgKWARMSRFRMDGLNVDHMQa-mT--TQDGPFSWITSGKVDAVLDIKFPR-GPtDElQINALLGELADAI 378
gi 302681701  304 GRTNEADTRdsDWARMSRVRIDGVNIDHLQ---RstSSDGPFSWITSGKVDAVLDIKFPH-DPeDElPFQLILGELADAI 379
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74607484   454 VKETRRHSGfi-----------------------------pGNFEEQKDI--DVKQYFIMDFLLRLHNVKAEVPLFTPGL 502
32_pfamImport 388 SVATSSGEstptdvamrhmslsdripgqrelakpalrspdgelerEESKTklGVGSEVVIDIDLRFRDLKAAVPIFTKDL 467
63_pfamImport 371 TTTVLSNTpdpilqripgqre------------lakpplsapeseDAADRvgNTEPKVVIDIDLRFRDVKAAVPIFTNDL 438
45_pfamImport 378 TTSISSNMneqeshperkripgqr-elarpplsapddnmyeGTGANSGEE--EEELKIIVDMDLRFRDLKAAVPIFNRDL 454
4_pfamImport  383 TTSLTNSQetedtrripgnrel---------akppisppslelleSVAKE--DEKRKVVVDIDLRFRDLKAAVPIFTSDL 451
22_pfamImport 375 STAASVSLlneripgqrel---------------akppltapqsdDFTED--DDTPKVIIDIDLRFRDLKAAVPLFASDL 437
44_pfamImport 375 TTAATSAVaeripgqrelak---------pplsapsdqtamPADS-------AEHPKIIIDIDLRFRDLKTAVPLFTADL 438
48_pfamImport 377 STAASSVAldripgqrelak-------------pplsppsdeedaRRPQH--EDKPRLVIDIDLRFRDLKAAVPIFTNDL 441
60_pfamImport 379 STAASSVAasaeripgqsrla-----------kpplsapsdrdstQLAET--AGEPQVVIDIDLRFRDLKAAVPIFTNEL 445
gi 302681701  380 SEHIPGQQQhipgqrel-----------------akpplsaP--DSDGIE--RAEPCVVIDIDLRFRDVKASVPIFTNDI 438
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74607484   503 SYINNALIRPIVGYINSRRTYIPIRCRVVKNLNDFAGSWTIYDSRLMDDLSAEVYDAFANYVADDERINLRMKRVGFWSL 582
32_pfamImport 468 SYANNALVRPIVAFINANRTLIPIHCTVVKELSEFDGSWTAWETGLTDAIALQVYGALAYHVTKMNMNR-RIKAVSSWSL 546
63_pfamImport 439 SYVNNALIRPIVAFMNANRTLVPIHCKVVKPLNDFEGAWTMWETGLMDEISLKIYDALAYHVAQANMNR-RIKTVSVWSL 517
45_pfamImport 455 SYVNNAFIRPIVAFMNANRTLVPIHCRIVKKLSDFDGSWTMWESGLMDEISIKTYDALAYHVSQSNMNRQRIRTVSLWSL 534
4_pfamImport  452 SYVNNALIRPIVAFMNANRTLVPIHCRIVKDLSDFDGSWTMWETGLIDEISLNVYEAMAHHVSQSAMNRQRMKTVSWWSL 531
22_pfamImport 438 SYVNSALIRPIVAFMNAHRTLVPIHCRVTKNLSDFDGAWTMWETGLMDEISEKTYDALAHHVAQVNMNR-RVKAVSIWSL 516
44_pfamImport 439 SYANNALIRPIVAFMNANRTLIPIHSRVVKDLSNFDGAWTMWETGLVDDIGAKVYEAMAYHVTQANFNR-RVKAVSAWSL 517
48_pfamImport 442 SYVNNALIRPIVAFMNVHRTLVPIRCHVVKDLSEFDGAWTMWETGLMDSIALKVYEAMAYHVTQANFNR-RIRAVSSWSL 520
60_pfamImport 446 SYTNNALVRPIVAFMNANRTLIPIHCRVVKPLSDFEGSWTLWETGLMDIISLKVYEAMAYHVTQANFNR-RLKVVSAWSL 524
gi 302681701  439 SVANNALIRPIVAFMNANHTLVPIRARVVKDLSEFDGAWTV--TGLMDDISDKIYNALAYHVTQANMNK-RLKTVGLWSV 515
                         570
                  ....*....|.
gi 74607484   583 QLIIQVILMSL 593
32_pfamImport 547 TMASQAVISAL 557
63_pfamImport 518 QMTASAVLSAL 528
45_pfamImport 535 QMTANAILSAL 545
4_pfamImport  532 QMTASAIISAL 542
22_pfamImport 517 QMTASAVLSAL 527
44_pfamImport 518 QMTASAILSAL 528
48_pfamImport 521 HMTASAILSTL 531
60_pfamImport 525 QMTASAVISAL 535
gi 302681701  516 QMTASAVLSAL 526
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap