Conserved Protein Domain Family
Toxin_32

?
pfam08120: Toxin_32 
Tamulustoxin family
This family consists of the tamulustoxins which are found in the venom of the Indian red scorpion (Mesobuthus tamulus). Tamulustoxin shares no similarity with other scorpion venom toxins, although the positions of its six cysteine residues suggest that it shares the same structural scaffold. Tamulustoxin acts as a potassium channel blocker.
Statistics
?
PSSM-Id: 71555
View PSSM: pfam08120
Aligned: 2 rows
Threshold Bit Score: 45.065
Threshold Setting Gi: 37089702
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30
               ....*....|....*....|....*....|....*
gi 20140754  1 RCHFVVCTTDCRRNSPGTYGECVKKEKGKECVCKS 35
gi 37089702  1 RCHFVICTTDCRRNSPGTYGECVKKEKGKECVCKS 35
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap