Conserved Protein Domain Family
Antimicrobial17

?
pfam08129: Antimicrobial17 
Alpha/beta enterocin family
This family consists of the alpha and beta enterocins and lactococcin G peptides. These peptides have some antimicrobial properties; they inhibit the growth of Enterococcus spp. and a few other gram-positive bacteria. These peptides act as pore- forming toxins that create cell membrane channels through a barrel-stave mechanism and thus produce an ionic imbalance in the cell. These family of antimicrobial peptides belong to the class II group of bacteriocin.
Statistics
?
PSSM-Id: 71564
View PSSM: pfam08129
Aligned: 2 rows
Threshold Bit Score: 100.204
Threshold Setting Gi: 75417288
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50
               ....*....|....*....|....*....|....*....|....*....|....*..
gi 75417288  1 MKQYKVLNEKEMKKPIGGESVFSKIGNAVGPAAYWILKGLGNMSDVNQADRINRKKH 57
gi 75404554  1 MKQYKVLNEKEMKKTIGGESVFSKIGNAVGPAAYWILKGLGNMSDVNQADRINRKKH 57
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap