Conserved Protein Domain Family
cIII

?
pfam08134: cIII 
cIII protein family
This family consists of the cIII family of regulatory proteins. The lambda CIII protein has 54 amino acids and it forms an amphipathic helix within its amino acid sequence. Lambda cIII stabilizes the lambda cII protein and the host sigma factor 32, responsible for transcribing genes of the heat shock regulon.
Statistics
?
PSSM-Id: 311862
View PSSM: pfam08134
Aligned: 2 rows
Threshold Bit Score: 65.8954
Threshold Setting Gi: 156533497
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40
                ....*....|....*....|....*....|....*....|
gi 156533497  2 MQLSLSGGGIMSAYYPTESELSKRFRRLIRAARKQLEALC 41
gi 260216101  2 MQLSLSGGGIMSAYYPTESELSKRFRRLIRAARKQLEALC 41
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap