Conserved Protein Domain Family
BING4CT

?
pfam08149: BING4CT 
BING4CT (NUC141) domain
This C terminal domain is found in the BING4 family of nucleolar WD40 repeat proteins.
Statistics
?
PSSM-Id: 336932
View PSSM: pfam08149
Aligned: 115 rows
Threshold Bit Score: 101.391
Threshold Setting Gi: 523781180
Created: 24-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121930249 374 PYMNWGG-DGLSISRVRYCPFEDVLGVAHERGFSSIIVPGAGEPNPDSMEqgLNPYETSKQRRETEVHALLEKLQPEMIA 452
gi 74977769  439 LYLTHNT-YGDKINSIAFQPFEDICCAGLKYSIKSFIVPGAGLANIDTFV--NNPYETKKQTKENEIRQLLDKLPPETIH 515
gi 122050690 333 LYLKHQF-NSQEIKSVAFQPYEDVCAVGTSFGLSNLIIPGSGLSNFDSLE--QNPYETGKIRKDREVQRLLEKLPPDSIT 409
gi 237832519 386 PYLTQHY-DSKQVESLAFRPFEDLCAVGLTTGIDTIVVPQSGIANFDTFE--ANPYETSAQRREREIHSLLEKLQPDMIT 462
gi 330805930 468 PYLIHK--NNSIANSVQFCPFEDVLGIGTQSGFSSTLVPGSGIANYDSME--ADPFASNKMKKEQEVKKLLEKIPHDMIT 543
gi 156087891 338 LYLRHMY-HGDQVNDIQFQPFEDICAVGTGTGFSTMLVPGAGIANFDAYE--PNPYESSSKRQ---VQRLLDKIPYDTMT 411
gi 749159397 340 mYMKHQYvNGLRFHSVRFRPFEDVLGCGLTQGMESLIIPGAGYANLDTLD--NNPYATNKEKARALVRRLLDKLPADTII 417
gi 672801826 335 vqrpgeT-HRDMITSCEFCPFEDFIAIGRYNGVSTIPIPGSGSAVVDTFE--NNIYESQKSYKESEVQKLLDKIPADMIT 411
gi 378756744 301 PEIQHHT-GRDLATSLTFMPYEDILAVGSKSGIENIIVPGAGLPTYRRNE---NPHVSRKEKKNSEVRRILEKIPADMIS 376
gi 906372662 301 PEVQHSM-GRDTAHSLTFMPYEDILTIGSTSGVENIIVPGSGRTVYRRHE---NPNLSRKEKRNSEVRRILEKIPADLIS 376

                 ..
gi 121930249 453 LD 454
gi 74977769  516 FK 517
gi 122050690 410 LT 411
gi 237832519 463 VD 464
gi 330805930 544 LD 545
gi 156087891 412 Lk 413
gi 749159397 418 LN 419
gi 672801826 412 LN 413
gi 378756744 377 LE 378
gi 906372662 377 LE 378
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap