Conserved Protein Domain Family
FerB

?
pfam08150: FerB 
FerB (NUC096) domain
This is central domain B in proteins of the Ferlin family.
Statistics
?
PSSM-Id: 336933
View PSSM: pfam08150
Aligned: 81 rows
Threshold Bit Score: 92.6259
Threshold Setting Gi: 242009399
Created: 28-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 74956036   611 QMTIPPVLIKMMSHGKLIGFAKIPISEIFQSDD-EAQSGEWCGRTRAINIQWPTLV-DQRNRKREHVAVLHAKMWFG 685
gi 780037793   67 QNCMPDVIIWMLSGSKRIAYTRFPAYHLLYSSRgEDACGKFCGKISSFFLKFPGKK-TANIGVKEIPGMLRAKLWLG 142
gi 242009399  591 ENSYPDTEIWIYRNGIKKSQLRIKTEDITYSSN-VHERGIFCGKIQTLIVRGKKQK---------IKGKLDVFLWFG 657
gi 942143819  705 QHSMPDVIIWMLCNEKRVAYARIKAHAVLFSSSgPNACGKSCGKMQTIFLKWsiatelmatilgmnqwpskltvqrp 781
gi 514682349  330 QLSIPDVILWILTDDQRRAYLRVPVSDIMFDEN-PAHRGKQFGQVQTAFMKLPAANrSKANQTGDIPAQIQFRAWFG 405
gi 754352715  823 QACIPDIIIWMISDKKRKAYVRIPVSDVLFADR-VDERGEFFGVARAVTLISPTAD-PKKKAESVIPARLQLKIWFG 897
gi 341882611  665 QISIPPVLIKLMSEGKLIGFAKIPIAEIFQSSS-DAQTGEWCGRTRPINIQWPTLM-DQRNRKKEYVAVLHAKMWFG 739
gi 156371753  572 QNSMPDVIIWMLSGTKRIAYYRIPAFDVLYEPY-SEACGENCGQVQNIFMKYPGKKqQNIEDYPEVPAHVRMMIWLG 647
gi 156371759  553 QNCMPDVVIWMLNGNKRVAYHRIPAYEVLFSHS-EQARGKHCGKVLSVFLKYPGKKqFDIEDHPEVPCKIDVALWLG 628
gi 156390184  575 QNCIPDVIVWMISGSERIAYYRIPAQEVLFSTT-PDACGKICGKTVELRLKYPGKKgQDLKDHPEIPALVRVELWFG 650
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap