Conserved Protein Domain Family
RIX1

?
pfam08167: RIX1 
rRNA processing/ribosome biogenesis
Rix1 is a nucleoplasmic particle involved in rRNA processing/ribosome assembly. It associates with two other proteins, Ipi1 and Ipi3, to form the RIX1 complex that allows Rea1 - the AAA ATPase - to associate with the 60S ribosomal subunit. More than 170 assembly factors are involved in the construction and maturation of yeast ribosomes, and after these factors have completed their function they need to be released from the pre-ribosomes. Rea1 induces the release of the assembly protein complex in a mechanical fashion. This family is usually associated with NUC202, pfam08166.
Statistics
?
PSSM-Id: 336945
View PSSM: pfam08167
Aligned: 93 rows
Threshold Bit Score: 96.9004
Threshold Setting Gi: 301121945
Created: 24-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74583175      9 SLPL-VKSWLAITfa-------nEE---------DLPFQVPQIADILVHQKC-IERlg------------tsEnALsvrK 58
gi 168001270    16 RPRL-LHAVMANHl---------PDdkqvtrtpgQLSMAVESLRQHHLLWESsILAcpelhymqgakvsdfnNgAV---D 82
gi 168045593    15 mathlaegkdvSEm---------PT---------LLSNAVASIRQHSLLRET-SRSpvasglkt-ksglnasKaAN---D 71
gi 156383793     6 avvvnallnedSTp---------EK---------YISTVLDCLEEKKSLQDS-RTTs----------------------- 43
gi 301121945    17 lsSV-LALAFPSEl---------EN---------DHAALESFLTQQAALREA-LERhnvfg-------lvtdGkAL---T 66
gi 1002856794   17 KLRLxGGGGGGRRpkpg--galpPA---------ELATVLDAVRTHGLLTER-LPGthdpk---------laeaWRaavD 75
gi 721655314    17 KPRL-LRAVVSERlpkag-stvpPA---------ELFSILEAVRTHGLLTES-HLDaldhk---------laeaWRaavD 75
gi 514711569    18 KPRL-LRAVVAERlpqpggaelpPV---------ELASVLDAVRTHGLLTEA-LPDrapadp-------klaeaWRaavD 79
gi 573878688    19 LLSA-LQEEQPGH----------------------LPGLLASYREHGGV-SA-QSAgv------------vgN------- 54
gi 512889457    15 ITGL-LERDLSEG---------------------ELAETIRGLREHGALRGE-GLPaa------------msG------- 52
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74583175     59 NWCTSLTKMLQSKDFRIRWSAIILIHCTISQS-W-DCLVEHGATWAKLLIALLNR-P--ETPKT--------LEIAMITV 125
gi 168001270    83 AWIEKLLNLLSSTVAENRWAGACLLGVTCQECtR-QRFLECYSLWFTKLLIPLKQ-Pt-DPIFV--------RAAACASL 151
gi 168045593    72 AWMEKVFRLLSDSVAENKWAGICLLGVTYREC-SrQRFLECFNSWSLKLLPFLKQ-Qt-EPVFV--------RAAACASL 140
gi 156383793    44 eWIGKVNGYLNSK--KERSLGLCMLEATIEQC-DtDAFNANCCTWVRALLQIIQSsP--ESRTT--------IHCAIQLL 110
gi 301121945    67 KWQTRLLQLVEGSSAARR-VGWELLQTTVRQS-PlERLEALAVKLLERIVKVLKQ-Q--QSSKTqdddaeyaTAAACGVA 141
gi 1002856794   76 AWVERIGELVQSDMPCSRWLGICFLGLTFQEC-SnERFAESYSNWFEKILSNLQG-Ps-SEQLV--------IIVSCTSM 144
gi 721655314    76 SWVDRVVELMASDSPYSCWLGTCFLGVTFQEC-SnMRFLQSYSDWFEKILRNLQE-Qs-SLELV--------TAVSCTSM 144
gi 514711569    80 SWVERVVALVVSDSAYSCWLGTCFLGVTFQEC-SnERFAESYSNWYEKILPNLQQ-EpsTLQLV--------TVISCTSM 149
gi 573878688    55 -LIGFSNARLSST--KTRFQGLCLLSVLVRDS-SsDVFQQHCLSWLRAVQQVIQS-Q--APLPS--------VQLAVTIL 119
gi 512889457    53 -LLSSCNSRLISA--GTRVEGLSLLALAVEES-PtGVFEQHCVSWLRSILQIIQS-Q--DPPRV--------VSLAVFVL 117
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74583175    126 SKMFSST-VGRPAV---T---RELVTPnLPTFVNNCLRIA---E---SGK-------------------CLCTVCSCLYQ 173
gi 168001270   152 TDLIVRL-GGLIEFagvR---RDGA-NlISKLVQPLLQILgdnD---SSG-------------------IWNEAMDLLSA 204
gi 168045593   141 TDLFVRL-AGFTEM---IgvrRDGSSL-ISKLVQPLLQII---G---DKDsnvllvcilhgtsedgvmiLWNEAMDLLIA 209
gi 156383793   111 ENILQYA-VQFSEL---S---RTLATSiLPSILGALLSLP---D---QLD-----------------------SLSGLSA 154
gi 301121945   142 QALLLHVdKFNPDT---R---REVLEL-LGKLLQPLVALL---RqtsNSP-------------------LVIAQLDLVAT 192
gi 1002856794  145 SDLFVRM-ARCLNL---K---KEASSF-AGRVVEPVLLLL---Ngn--gP-------------------VANEAVDLLRT 192
gi 721655314   145 SDLFVRL-ANFLNL---K---KEASSF-AGRVVELLLLLL---Nen--gP-------------------VVDEAVDLLTT 192
gi 514711569   150 SDLFVRL-AKFSNL---K---KEASSF-AGRIIESVLRLL---Nen--gL-------------------VADEAIDLLCT 197
gi 573878688   120 QDLLQYS-SQLPEL---S---REIGLNsIPGILTSLLGLK---Qe------------------------cHLGAMEGMTA 165
gi 512889457   118 RSLLAHS-SALPEL---S---REISTNhIPGLLTSLLGLR---Rq------------------------cLVPALEGIRS 163
                          250       260       270
                   ....*....|....*....|....*....|.
gi 74583175    174 GIISHSPTFRPFVSSIRNICIKILDGEEVVP 204
gi 168001270   205 LLRYFPACLRQQSSSFEALLVARIMDVECft 235
gi 168045593   210 ILKSFPSCLRAQSINIEVLLVARLTDLSCQS 240
gi 156383793   155 CMRHMPGPAGAVKVQIEDLVVSCFEHSNENI 185
gi 301121945   193 LLRSSPNSLRSYAIKIESACVDLLFTCERDN 223
gi 1002856794  193 VIKLYPSSVNRHYNKVESSIATNVMSSEVNV 223
gi 721655314   193 VIKLYPSSVNRHYNRVESAIAAKIMSTEVNV 223
gi 514711569   198 VIKLYPSSVNRHYNKVESTIAAKVMSTEVNV 228
gi 573878688   166 CMTYYPRACGSLREKLGAYFLSKMDSDNPKI 196
gi 512889457   164 CFISYPRACGSLRGKLTAFLLSLIDAENQQI 194
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap