Conserved Protein Domain Family
POPLD

?
pfam08170: POPLD 
POPLD (NUC188) domain
This domain is found in POP1-like nucleolar proteins.
Statistics
?
PSSM-Id: 336947
View PSSM: pfam08170
Aligned: 152 rows
Threshold Bit Score: 83.7495
Threshold Setting Gi: 749165169
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74683458   491 GFTLLFPSSWAQYLLTSIAYTGTLIGGLNERKVQHREAGTPSFPEHFGQVcVAGGKWEESKAEEAEGRWKRKPPAKRVAF 570
gi 1028722334 496 GWDIVLPAGWAMPFWLGLIMNGCQPGGLRETTTMVLERCLPR-P-DEPDT-DAGNLRAMLEKEEAMKKHFRLPPQMRVNY 572
gi 194763623  519 GWDVIAPAGYGMLLWLTLTMWGARPGGLRELDSVAREAGSEMHL---PDT-VAGVQEANAVADERRARYFRLPPNKRTNY 594
gi 321476470  403 GCDVILPAGWATAFWLALIYSGGHAGGLKDAGSMNFEYGICRDLCLEIDS-EAGKATAVDRKMNLMEEYFRRPPKTRTNF 481
gi 512928231  464 GWDIIVPAGYGVPFWLTFIMFGGRSGGLRETENLAFEMGECYFP---PDS-AAGKLEEKRIENELKEKYFRLPPSKRVNY 539
gi 357608426  441 GWDIILPAEYGLPFWLTFIMFGARTGGLRETESVALEMGEIYMP---PDS-EAGLLEEMRLESELKEKYFRRPPSKRVNY 516
gi 968099145  520 GWDVIVPARYGMVLWQTLIMWGARPGGLREFDSVARESGIDHYL---PDT-VAGQQQATQTAKERRAQYFRQPPNKRCNY 595
gi 195044305  479 GWDVIAPARYGMSLWLTLIMWGARPGGLREFDTVAREMGVEHHL---PDT-VAGRDQASRAAAERRTRYFRLPPNKRCNY 554
gi 1036874974 523 GWDVIAPAGYGMILWLTLNMWGARPGGLRELDSVAREAGAEMHL---PDT-IAGVQEANVLADEQRARYFRLPPNKRTNY 598
gi 170043724  485 GWDVIVPSGYGLVFWHTLILWGAKPAGLKEFTMQAIESGIDS--ERVPDS-VLGRTESDLAFETNWSSYFAKPNNRRVNY 561
                          90
                  ....*....|...
gi 74683458   571 dklgtsrPWIPDW 583
gi 1028722334 573 iklgfptPFHCPW 585
gi 194763623  595 rklavvsPFSAPW 607
gi 321476470  482 iklatpfPFCVDW 494
gi 512928231  540 iklginsPFICPW 552
gi 357608426  517 iklavpsPFKCPW 529
gi 968099145  596 rrlsvvsPFVAPW 608
gi 195044305  555 rklavvsPFLAPW 567
gi 1036874974 599 rklavvsPFKAPW 611
gi 170043724  562 kklaiasPFRCPW 574
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap