Conserved Protein Domain Family
POPLD

?
pfam08170: POPLD 
POPLD (NUC188) domain
This domain is found in POP1-like nucleolar proteins.
Statistics
?
PSSM-Id: 311891
View PSSM: pfam08170
Aligned: 153 rows
Threshold Bit Score: 82.976
Threshold Setting Gi: 443897793
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21542491    402 GADILIPEPFAKDFWVSLQRRGVRASGLRDEYAA-HLESKALYYPLDDVGSEAGRESELAMKKELIEKYLGKPHNRRCKH 480
gi 260781485   528 GWDVIMPAGWAMAFWLGFMYRGARAGGLREMRRL-HLETGQLFFPDDFPDTGAYRTLQQEQAAKLREQHDRYPPGKRPNF 606
gi 196008863   381 GWDLILPAGWGMPFWLSLIYCGARAIGLQESAKQ-YLEQGIPIFPSDYPDTAAGCINAVATHQKLTSDYYLRPPAKRINY 459
gi 762135545   563 GWDLILPAGWSMAFWVASIYHGARAGGLRELQCL-ANEQQIEHFPEDYPDTSAGREEEARVKSEKEAEHSRRPPAKRPNF 641
gi 780019451   151 GWDVVLPRKWGMPFWIGLVYRGARACGLREAGKV-ALHRSMPRFPYDYPDSDAGCDISKSIADDLEQTFLRKPPAKRSNH 229
gi 761902797   527 GWDVILPSRWGMSFWISLIYRGARPLGFNELNTCcHLENLSPLFPRDYPDTVAGRDEEIQTLSECSSQYGRYPPDKRPNF 606
gi 973139952   613 GWDLLLPKGWGMAFWIPLIFRGVRVGGLQEALKH-SQNKGAPHFPGDFPDCPAGARFLREQETQLVDHYRRRPPAKRPNY 691
gi 126322136   621 GWDILLPKGWGMAFWIPFIYRGARVGGLKEGLIH-SRYKGAPSIPDDYPDCPAGILFATEQENNLLEKYKRHPPAKRPNY 699
gi 1034182215  525 GWDVLLPKGWGMAFWIPFIYRGVRVGGLKESAVH-SQYKRSPNVPGDFPDCPAGMLFAEEQAKNLLEKYKRRPPAKRPNY 603
gi 823456817   492 GWDICLPKGWGMAFWIPFIYQGVRVGGLQEALKH-SEYQRTPHIPNDFPDCRAGMQFAKELETSLLEKFKRRPPAKRANY 570
                           90
                   ....*....|...
gi 21542491    481 wsavsvkyPFEFK 493
gi 260781485   607 arlg-taaPFHCP 618
gi 196008863   460 skig-ilsPFLNR 471
gi 762135545   642 tkld-vanPFSWA 653
gi 780019451   230 aklg-iaaPFCPP 241
gi 761902797   607 gklr-iasPFLPQ 618
gi 973139952   692 ikhg-claPFRCP 703
gi 126322136   700 vkhg-tlsPFRCP 711
gi 1034182215  604 vklg-tlaPFCCP 615
gi 823456817   571 vklg-tlsPFICP 582
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap