Conserved Protein Domain Family
Cuticle_2

?
pfam08184: Cuticle_2 
Cuticle protein 7 isoform family
This family consists of cuticle protein 7 isoforms that are isolated from the carapace cuticle of a juvenile horseshoe crab, Limulus polyphemus. There are 3 isoforms of cuticle protein 7. The 3 isoforms are N-terminally blocked but could be deblocked by treatment with pyroglutaminase, showing that the N-terminal residue is a pyroglutamine residue.
Statistics
?
PSSM-Id: 116772
View PSSM: pfam08184
Aligned: 3 rows
Threshold Bit Score: 56.9845
Threshold Setting Gi: 24636291
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50
               ....*....|....*....|....*....|....*....|....*....|....*....
gi 24636290  1 QAVRYANGYTYDIETGQVSSPYTGRVYETKGKAPFYGFGFEHPYHYYPGYYHGYPHAFY 59
gi 24636292  1 QAVRYADGYTYDIETGQVSSPYTGRVYETKGKAPFYGFGFEHPYHYYPGYYHGYPHAFY 59
gi 24636291  1 QAVRYANGYTYDIETGQVSSPYTGRVYETKGKAPFYGFGFKYPYHYYPGYYHGYPHVFY 59
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap