Conserved Protein Domain Family
Protamine_3

?
pfam08188: Protamine_3 
Spermatozal protamine family
This family consists of the spermatozal protamines. Spermatozal protamines play an important role in remodelling of the sperm chromatin during mammalian spermiogenesis. Nuclear elongation and chromatin condensation are concomitant with modifications in the basic protein complement associated with DNA. Somatic histones are initially replaced by testis -specific histone variants, then by transitional proteins, and ultimately by protamines.
Statistics
?
PSSM-Id: 71622
View PSSM: pfam08188
Aligned: 2 rows
Threshold Bit Score: 44.4706
Threshold Setting Gi: 25090953
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40
               ....*....|....*....|....*....|....*....|....*...
gi 25090955  1 ARRRHSMKKKRKSVRRRKTRKNQRKRKNSLGRSFKAHGFLKQPPRFRP 48
gi 25090953  1 ARRRHSMKKKRKSVRRRKTRKNQRKRKNSLGRSFKQHGFLKQPPRFRP 48
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap