Conserved Protein Domain Family
TRI9

?
pfam08195: TRI9 
TRI9 protein
Putative gene of 129 bp in the Trichothecene gene cluster of Fusarium sporotrichioides and F. graminearum. Encoding a predicted protein of 43 amino acids which function is unknown.
Statistics
?
PSSM-Id: 311904
View PSSM: pfam08195
Aligned: 2 rows
Threshold Bit Score: 62.872
Threshold Setting Gi: 74612913
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40
               ....*....|....*....|....*....|....*....|...
gi 74612913  1 MLAAAKLIDSYEMDPDVSWLEVFAYSGVSAALCATIWVAAKAC 43
gi 74612913  1 MLAAAKLIDSYEMDPDVSWLEVFAYSGVSAALCATIWVAAKAC 43
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap