Conserved Protein Domain Family
TRI9

?
pfam08195: TRI9 
TRI9 protein
Putative gene of 129 bp in the Trichothecene gene cluster of Fusarium sporotrichioides and F. graminearum. Encoding a predicted protein of 43 amino acids which function is unknown.
Statistics
?
PSSM-Id: 336952
View PSSM: pfam08195
Aligned: 2 rows
Threshold Bit Score: 56.7109
Threshold Setting Gi: 758199609
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40
                ....*....|....*....|....*....|....*....|...
gi 21429319   1 MLAAAKLIDSYEMDPDVSWLEVFTYSGVSAALCATIWVAAKAC 43
gi 758199609  1 MLAAAKLIDSYEMDPDVSWLEVFAYSGVSAALCATIWVAAKAC 43
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap