1H9E


Conserved Protein Domain Family
Thymopoietin

?
pfam08198: Thymopoietin 
Click on image for an interactive view with Cn3D
Thymopoietin protein
Short protein of 49 amino acid isolated from bovine spleen cells. Thymopoietins (TMPOs) are a group of ubiquitously expressed nuclear proteins. They are suggested to play an important role in nuclear envelope organisation and cell cycle control.
Statistics
?
PSSM-Id: 311905
View PSSM: pfam08198
Aligned: 16 rows
Threshold Bit Score: 81.2483
Threshold Setting Gi: 195996631
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*..
1H9E_A         2 EFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARN 48
gi 82183275    3 VFVEDPAQFSKERLKSELIAHNVALPPPESKKHAYVELYLKHVKTNS 49
gi 47224431    3 EFLEDPSVLTKDKLKNELVANNVPLPSGEHKKEVYVQLYLKNLTVQN 49
gi 597772538   3 VFIEDPTEFSKEQLRSALISHNVELPPGESRKEVYVDLYLKHVRNKN 49
gi 47229251    2 PLLEDPARLSKSRLKSDLLAHNMALPPANSRKEVYVELHLKHIEQRN 48
gi 768943534   3 EYLDDPSVLTKDKLKSELLAHNVDLPSGNPTKDVYVQLYLKELTSQN 49
gi 66472550    3 QFHEDPALLTKEKLKSELMANNVALPSADSKKDVYVQLYLKNLTVLN 49
gi 765125912   2 PFVEDPAHLSIARLKSDLLAHNVALPPAASKKEVYVELHLKNIDQKN 48
gi 941786699   2 PFVEDPACLSKSRLKSDLVAHNVELPPAGSKKEAYVALHLRHVDQTN 48
gi 972961688   3 VFVDDPVLLSKERLKSELVAHSVPLPPGEKKKQVYLELYLKHVAHKk 49
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap