1YBY,5J3B,3OYY,1UEB


Conserved Protein Domain Family
EFP_N

?
pfam08207: EFP_N 
Click on image for an interactive view with Cn3D
Elongation factor P (EF-P) KOW-like domain
Statistics
?
PSSM-Id: 336954
View PSSM: pfam08207
Aligned: 181 rows
Threshold Bit Score: 48.9517
Threshold Setting Gi: 81658859
Created: 28-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*..
1YBY_A        33 SAGDFKNGVTFELDGQIFQVIEFQHVKPGKGAAFVRTKLKNIVTGATIEKTFNPTDK 89
gi 166221153   3 TTSDLRTNMIIRYNGQLHRVVEFYHHAPGNWRAMVIMKLKNLETGKTIEERVRAGSe 59
gi 189027879   5 TTSDLRNGIVIRYNNDLYQVVEFQHVAPGNWRAFVRMKLKSLTTGKVIEDRVRAGAe 61
gi 123256224   4 PATQMRPGMVIKHNNDLHSVFSVEHRTPGNLRAFIQAKLRNLRTGAMFEHRFRSGDP 60
gi 31563056    3 SISNVSRGAIIRWNGAPHSIESLVHRTPGNLRAFYQASMKNLKTGRNVEYRFSATEQ 59
gi 51315765    3 RGGDIAKGTVLLNKGTPYLVVEREFVNPGKGAAFARVKMKNLRDGSVLMQTIKTADT 59
gi 3913564     5 kSSEIEKGSFLLIKGAPHIVLEREFSKTGRGGAIVRLKLKNLKNKFVIRETLKGADt 61
gi 51315857    3 TSNQLTPGMTLSINNKLYRVESSVKVTVPKGTPFIKAKLKDLSNNEMVEKSFKlnqp 59
gi 31563049    4 giTEVKKGMVLKVEGDLYSVVKTEFVNPGKGSAFIRTKLKNLTRNSSIERTFKAAEK 60
gi 941476287   3 KASDIKNGNILRFNGELVQVEEFLHRTPGNLRAFYQARMRNVKTGKLVEYRFRVDEE 59
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap