Conserved Protein Domain Family
EFP_N

?
pfam08207: EFP_N 
Click on image for an interactive view with Cn3D
Elongation factor P (EF-P) KOW-like domain
Statistics
?
PSSM-Id: 311911
View PSSM: pfam08207
Aligned: 178 rows
Threshold Bit Score: 49.3397
Threshold Setting Gi: 81658859
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*....
3OYY_B         6 TAQEFRAGQVANINGAPWVIQKA-EFNKSGRNAAVVKMKLKNLLTGAGTETVFKADDKL 63
gi 75331833   74 NAIQLRAGNVIERTGRTFRVVEA-EHKQQGRGGASIQVELRDVDTGNKLNLRFGSEESV 131
gi 254782606   4 rGSDIRPGQILDHNGSLYLVVKT-MHTQPGKGGAYIQAELKNLKTGAKYQERFRSDgyv 61
gi 123099540   4 SGVDIRPGNIIEYEGGIWKVAKI-QHTQPGKGGAYMQVEMKNLQDGRKTNVRFRSADTV 61
gi 123400987   5 NGNEIRPGNVLEHNGGLWAAVKV-DHVKPGKGGAFAQVELRNLRNGSKLNERFRSADKV 62
gi 88911294    4 nGNEIRPGNVIEHEGGLWVAVKT-NAVKPGKGGAYNQVELKNLINGTKLNERFRAAESV 61
gi 166220256   4 LANAIREGNILEYQNNLWIVSKKpDHTKPGKGGAYIQLEMKNLKTGTKIYERFSSSDYL 62
gi 6225292     4 SANSIRTGNILVYNNDLWVVSKTpEHTQPGKGGAYVQVEMKNLKTGTKRNDRFSSSDYl 62
gi 123775522   4 yASEIRVGMLIEYKNDLWQVLKT-QHVKPGKGGAFAQVEMKSVNKNTKLNERFRSSESV 61
gi 494958820   4 sgvEIRPGNNIEYDGSLWRAVKI-QHTQPGKGGAYMQVELKNLIDGRKNNVRFRSAETV 61
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap