Conserved Protein Domain Family
Lipocalin_2

?
pfam08212: Lipocalin_2 
Lipocalin-like domain
Lipocalins are transporters for small hydrophobic molecules, such as lipids, steroid hormones, bilins, and retinoids. The structure is an eight-stranded beta barrel.
Statistics
?
PSSM-Id: 336958
View PSSM: pfam08212
Aligned: 18 rows
Threshold Bit Score: 159.049
Threshold Setting Gi: 81534619
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75248075  16 LD-VARYMGRWYEIASFPNFFQpRDGRDTRATYELMEDGaTVHVLNETW---SKG---KRDFIEGTAYKADPASeEAKLK 88
gi 81792462  29 LD-LSRYLGTWYEIARLPIRFEdADCTDVSAHYSLDADG-GIRVQNRCFt--AKG---ELEEAVGQARAIDET--GARLE 99
gi 81750101  61 VD-LERYQGKWYQVAAIPQPYTlQCSNDTTAEYEKIDEN-TISVANSCGt--PFG----PSVIQGKATVRS----DASLK 128
gi 81761386  61 ID-LERYKGKWYQVAAIPQPFSlQCSHDVTADYGVIDSD-TISVTNKCGt--FFG----PSVIEGSAKVVS----NASLK 128
gi 81534619  24 IDpARHYSGVWMEVGRTPMRIT-KGCVAATTVYNRVDER-RIAVEDDCRqggVEG---KRRAIKGDGVIEDPGV-NRRLK 97
gi 81620916  38 VE-LDRYLGKWYEVARYDMRFQ-KGCEGVTAEYSRRPDG-LIRVFNTCRqdaVDG---PVRTAEGKAKVVDTAT-NAKLK 110
gi 75262454  13 LN-VERYMGRWYEIASFPSRFQpKNGVDTRATYTLNPDG-TIHVLNETW---SNG---KRGFIEGSAYKADPKSdEAKLK 84
gi 81586590 293 LD-LKRYMGLWYEIARYDHRFE-RGLMEVTATYTLRPDG-TIRVENRGYk--RNSpydICRTATGHAKIPDPAQ-PGKLK 366
gi 81790752  31 FK-LDRYLGTWYEIARIDNWFE-RGSDHVSATYTLRDDG-KVQVLNKGYy--PDKk--KWKTAKGKAKFAGSPN-VGALK 102
gi 81792249  38 VD-VPRFMGDWYVIAHIPTRPE-RKAFDAVERYALRPDG-RIQTTFTFRkgsFQA---PLKSMHPVGQVAKEGN-GALWS 110
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 75248075  89 VKFYVPPFLpIIPVVGDYWVLYVDDD-YQYALVGEPRRKSLWILCRKTHIEEEVYNQLLEKAKEEGYDVAKLHKTPQ 164
gi 81792462 100 VTFLPEGLRwIPFTKGDYWVMRIDSD-YTAALVGSPDRKYLWLLARLPQLDENIAQTYLAHAREQGFDLAPLIHTPH 175
gi 81750101 129 VTFGGVPFQ-TEEGEPNYRVTYLEDD-YSLAIVGSPNRLSGFVLSRTPDLSPEDWTKVRNITEDRGWWSCAFVTVPA 203
gi 81761386 129 VSFPGIPFQ-SEDNQANYRVTYIEDD-YSLAIVGSPSRSSGFILSRTPQLSSDQWSHVRNITEDSGWWPCAFITVPA 203
gi 81534619  98 VSYLP-------FVTWRYEVLDQDPA-GAWFISASPDRRKVFLYTRAPA-SPELLKTMTERARALGY-AGEIEYPAP 164
gi 81620916 111 VSFFGPFF-------GDYWVMDHADD-YSWAIVGEGSGRYLWLLSRQPP-SDADRVALTARAKALGYDVGLLRPTKQ 178
gi 75262454  85 VKFYVPPFLpIIPVTGDYWVLYIDPD-YQHALIGQPSRSYLWILSRTAQMEEETYKQLVEKAVEEGYDISKLHKTPQ 160
gi 81586590 367 VSFFL-------NFYSDYYVMELDQEnYNYALIGSSTDKYLWILSRTPQLPEDIKKKLVTAAERRGYDTNRLQWIEQ 436
gi 81790752 103 VSFFG-------PFYGPYNVFALDREnYSWAMVTASSRDYFWILARTPQIDDALYEKLLEKAKSQGFDTAKVMRTLQ 172
gi 81792249 111 MQFLW-------PFKAEYVIAWRDAN-YTQTIVARSKRDYVWYMARTPQVSDADYQQAVGRIAAMGYDVTQLRRVPQ 179
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap