Conserved Protein Domain Family
DUF1713

?
pfam08213: DUF1713 
Click on image for an interactive view with Cn3D
Mitochondrial domain of unknown function (DUF1713)
This domain is found at the C terminal end of mitochondrial proteins of unknown function.
Statistics
?
PSSM-Id: 311916
View PSSM: pfam08213
Aligned: 25 rows
Threshold Bit Score: 32.6673
Threshold Setting Gi: 543279697
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30
                 ....*....|....*....|....*....|.
5AJ3_n       127 CKNILKIRRRKMNHHKYRKLVKRTRFLRRKV 157
gi 593747815 127 CKNVLKIRRRKMNHHKYRKLVKRTRFLRRKV 157
gi 664779261 250 CKNVLKIRRRKMNHHKYRKLVKRTRFLRRKV 280
gi 196007990 133 CGSVMKKRRKKIKLHKLKKKRRRDRFKVKRt 163
gi 953868801 114 YKNVLKIFQCKISRHKYSKLFKRIQFLKQKs 144
gi 543279697 123 CRNVLKIRRRKMNRHKYRKLLKRRKFIRRRI 153
gi 327288046 133 CKKILKIRRRKMNKHKYRKLMKRTKFLRKKI 163
gi 321476575 107 AARMIVIRRRKMKKHKLKKLRKVRKFEYRRM 137
gi 751203368 122 AVNMLRIRHKKMKKHKLKKLRKKMKFVWAKL 152
gi 281205924 134 MSSIIKKRKLKMTKHKQRKLRKRMRSLKKRL 164
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap