5AJ3


Conserved Protein Domain Family
DUF1713

?
pfam08213: DUF1713 
Click on image for an interactive view with Cn3D
Mitochondrial domain of unknown function (DUF1713)
This domain is found at the C terminal end of mitochondrial proteins of unknown function.
Statistics
?
PSSM-Id: 336959
View PSSM: pfam08213
Aligned: 26 rows
Threshold Bit Score: 32.2779
Threshold Setting Gi: 543279697
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30
                  ....*....|....*....|....*....|.
5AJ3_n        127 CKNILKIRRRKMNHHKYRKLVKRTRFLRRKV 157
gi 593747815  127 CKNVLKIRRRKMNHHKYRKLVKRTRFLRRKV 157
gi 664779261  250 CKNVLKIRRRKMNHHKYRKLVKRTRFLRRKV 280
gi 196007990  133 CGSVMKKRRKKIKLHKLKKKRRRDRFKVKRt 163
gi 543279697  123 CRNVLKIRRRKMNRHKYRKLLKRRKFIRRRI 153
gi 327288046  133 CKKILKIRRRKMNKHKYRKLMKRTKFLRKKI 163
gi 321476575  107 AARMIVIRRRKMKKHKLKKLRKVRKFEYRRM 137
gi 751203368  122 AVNMLRIRHKKMKKHKLKKLRKKMKFVWAKL 152
gi 167519046  173 ASSVLKKRRRKMKRHKYKKWRKKMRSVLKKy 203
gi 1160559363 134 MSSIIKKRKLKMTKHKQRKLRKRMRSLKKRL 164
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap