Conserved Protein Domain Family
HTH_9

?
pfam08221: HTH_9 
Click on image for an interactive view with Cn3D
RNA polymerase III subunit RPC82 helix-turn-helix domain
This family consists of several DNA-directed RNA polymerase III polypeptides which are related to the Saccharomyces cerevisiae RPC82 protein. RNA polymerase C (III) promotes the transcription of tRNA and 5S RNA genes. In Saccharomyces cerevisiae, the enzyme is composed of 15 subunits, ranging from 160 to about 10 kDa. This region is a probably DNA-binding helix-turn-helix.
Statistics
?
PSSM-Id: 311921
View PSSM: pfam08221
Aligned: 17 rows
Threshold Bit Score: 66.1
Threshold Setting Gi: 74621431
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
5FJ8_O        47 FLYKELVKAHLGERAASVIGMLVALGRLSVRELVEKIDg-MDVDSVKTTLVSLTQLRCVKYLQE 109
gi 218511817  17 NLYTTLAKTHLGEVAAIIVSTLISYGRLTAKDLSNKSE--VPLKLVKSTLVSLIQLSCISYWKE 78
gi 74609953   66 FLYTEVIKSYLGERASTVISLLISLGRLTVREIYEKLNftMSIDSIRRTLVSLTQLRCVRYLEE 129
gi 74607505   51 FLYSELARSHLGERASTVLSVLVNKGRLSTREIHSFIPe-LSLSSIKTVLVSLIQLRCVQYLEE 113
gi 74693899   35 FLYTEVARSHLGERAGRVIELLLNKGRLSVSELVHLAPe-LGSKSVRTVLVSLIQLRCVQYLEE 97
gi 74621431    3 GLVTEILAD-YGTIPQKISLFLKKRNGSTVDQMLQNTS--LTRIQVVHGLSLMIQRRLVKYFQY 63
gi 74868920    7 HLSSAILEQCFGKVVQAVADCLFSATTRTLGQITSATK--LSRKEVAFALAVLVKFRLVDFAAS 68
gi 75015850    9 QMCVIIIEDIFGKIVAKVMETILKESCQLSTLFYKLKGq-ISNTLIRKSVSTLINFGFVTFHLD 71
gi 74622578    9 ECCTLLVDELYGQLPARVYATLFQRGKLSVRLISQFSK--LSARQVKNGLCVLQQHNLLFYSVD 70
gi 74623716    7 ELCEILVEEFFGDCCSAVASALLRHGRLTIPMLQKRTS--LPGPKIRQALVSLMQHHMVLYVTV 68
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap