Conserved Protein Domain Family
HTH_CodY

?
pfam08222: HTH_CodY 
Click on image for an interactive view with Cn3D
CodY helix-turn-helix domain
This family consists of the C-terminal helix-turn-helix domain found in several bacterial GTP-sensing transcriptional pleiotropic repressor CodY proteins. CodY has been found to repress the dipeptide transport operon (dpp) of Bacillus subtilis in nutrient-rich conditions. The CodY protein also has a repressor effect on many genes in Lactococcus lactis during growth in milk.
Statistics
?
PSSM-Id: 116808
View PSSM: pfam08222
Aligned: 4 rows
Threshold Bit Score: 100.427
Threshold Setting Gi: 814312619
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|
2B0L_A        41 EGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGTYIKVLNNKFLIELEnlK 100
gi 81436972  203 EGRLTASSIADEIGITRSVIVNALRKLESAGIIESRSLGMKGTYLKVLNQQFIKELE--K 260
gi 814312619  47 EGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGTYIKVLNDKFLHELAklK 106
gi 54036884  202 EGRLTASVIADRIGITRSVIVNALRKLESAGIIESRSLGMKGTYLKVINEGIFDKLKeyN 261
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap