Conserved Protein Domain Family
DUF1719

?
pfam08224: DUF1719 
Domain of unknown function (DUF1719)
This is a domain of unknown function. It may have a role in ATPase activation.
Statistics
?
PSSM-Id: 336962
View PSSM: pfam08224
Aligned: 45 rows
Threshold Bit Score: 282.149
Threshold Setting Gi: 122167748
Created: 26-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122167745 101 CSFPRRIAHETRSFFS---SF------S----GDKnvdslITTSTIQRFERFADGAGEFLRFLQF--GSIGSINyMLVDP 165
gi 122167748 133 SYFPKQFVQAVKAMKSyvlSF------Lgm-nKQYl----LSCSHVRRFEWFAKKAGKFARDVET--GRTLWHY-NFFSS 198
gi 75139035   98 GGFTKRIFRAVKSSIS---SL------Igm-dKDEa---sYSDDAVRRFEWFADKAGKFVRDVET--GCSLAHY-RFFSP 161
gi 944079577 112 SFFPRRIALVARSCIS---SLgnyyctIrn-gGSEas--aGSTAAVRRFERLADSAVEFIRFVELagGSRPRQR-MFMDP 184
gi 944258051  84 lqqegqeigrvcrglnlslSL------Igl-kKDEsp--cLSCSDVKRFEWFADCASKFVRDMES--GCSLRQY-TFCNP 151
gi 474404457  91 rsLRRKIMHAV---LP---SF------Ivp-nQDA-----LSSSVVGRFEQFVKEADRFVRDVES--GSSLSHY-RFLSS 149
gi 514812071 103 HSFSKWIAHVTQSSVS---SY------FtgfcKDN-----ISCSDVRRNEWFAECANRFLRDVES--GCSPLRC-VFSNP 165
gi 721647854 103 SSFPRRIAHTTKAFIS---SF------Vgr-dNDHc---sDNIAAVRKFERFADGATEFMRFVQF--GGTPRQH-LFFDP 166
gi 473788562 103 SSLPRRIAHTTKTFIS---SF------Vgr-kNDHc---sDNITSVRRFERFADGATEFIRFVQL--GGTPRHH-MFFDP 166
gi 721647848 103 SSFPRRIAHTTKAIIS---SF------Lsr-nNDHc---sYNISDVRRFERFADGATEFMRFVQL--GGTPRHP-LFFDP 166
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122167745 166 LTGPLLAGKALQFEN--PP-GISGY-YLAARPLRFAERGVVACVFLQYKNHERPEENFLLGILIRVTASTNVVGIMARCS 241
gi 122167748 199 LIRPLLEGKHLKYDMp-LQ-GSKTL-GITIVPVSLEGRGVEALIQLNKEDSRMPLKNFCLLLILRLSESTDIVRIIINCL 275
gi 75139035  162 LIKHLLEGKRLCYEL--VQ-RSQTL-RLEIDPVRSKERGVEAEIRLCNDNVTMLTRSFNLRLILRLSESTDIVGIIISCL 237
gi 944079577 185 LIRHLLAGREINYELgsPR-GSSHRqFFGIRPISFEERGVEAKLCYDYQDHKAREKSFRLGTMLRLSESTDIIGTIINCL 263
gi 944258051 152 LVRHLLQGKMLEYEV--VQ-RDLLR-RFHIWPISLEERGVEAELAYRYDDRKMPHKSFQLRLMLRLSESTDIIGIAIECL 227
gi 474404457 150 PIRHLLEGKGLYYDM--VQ-GSKAF-SLGISTDSVEEYGRVAWLCFHYKDRKAPLKTCRLVVALRLYESTNIVGITAKCL 225
gi 514812071 166 LVRQLLEGKTLEYKM--VQ-GSILR-CLHIQSMCVEGRGVEATLEFRYEDRKTPMRSFSLKLMLRLSESTDIIGTAIRCL 241
gi 721647854 167 LIGHIFAGKSIRYMG--LLpGARHH-FFSLWPIAFEERGLEAMLFYAYEDCKVLENSFALGFMMRVLESTDIIGTTVKCL 243
gi 473788562 167 LIRHIFEGKSIRYMV--LHpGGQYH-FFTIQPIASEERGLEAILCFVYEDCKLPEKSFALKFMMRISESTNLIGTTVKCL 243
gi 721647848 167 LVGHIFAGKFIRYMV--LHpRGGYH-CFAIQPVVSEERGLEVTLYFLYEDCKVFENSFTLGLMMRISESTDIIGTTVKCL 243
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122167745 242 EKLT---SNFKPVTEAVRQELAQFHQR---GFY--CFPfVASt--DPEYS-RIHqs-----eTH--R-ARPNPACCeE-E 301
gi 122167748 276 QLLG---PHFTRLAKDAIGQLAALQHShpqDLEplLALqAVD---YHRSFlAFR--------AT--V-ARPDPFCC-R-E 336
gi 75139035  238 QSFG---PHFKSLVENAKNTVAELPTQ---DVLn----------sSARIFfALPsdtlyegsAT--T-YRPDPLCC-R-T 296
gi 944079577 264 QLVTakvPHFKPSAEAAIREITQLPTQ---DFS--CNKpYVVs-dDTEHW-NYHni-----lTE--W-FRPDPLCC-KdR 327
gi 944258051 228 QSL-----ESQHVTRSAMGELTLL--R---DLQ--FGKd-ISh-kYALPWvGIQes-----hTQdtWiFRPDPICC-K-S 286
gi 474404457 226 RSLG---PQFKSLVEDATGELSHLPTQ---DVS--YF--------DSVMWeCMVk------lTT--E-SIPDPFCCiA-N 279
gi 514812071 242 QSFM---SSMKDVTEAAVRELTQLPLQ---DISh----------sHAASCfTIKdlc--sydTH--L-WRPDPLCCkP-- 298
gi 721647854 244 RLVT---PHFKSTADVVTKEIMQLPTQ---DFS--CLPlEVAnanVEQYWnDIHtt-----fAG--W-FRPDPLCC-Q-G 305
gi 473788562 244 QLVT---PHFKSTAEIVIKEIAQLPTQ---DFS--CLPpEVMsvnAEHYWnEMNtt-----fAV--C-SRPDPLCC-Q-G 305
gi 721647848 244 GLVT---PHFKSTADIVIKEITQLPTQ---DFF--CSPpEVTsadAKNHWtEMHtt-----fST--W-FRPDPLCC-Q-G 305
                        250       260       270
                 ....*....|....*....|....*....|....*...
gi 122167745 302 HEHHGRRRSSDMV-------EPLGAFPEPVIKLVVQRH 332
gi 122167748 337 KRLDPCADNTISP-------NLPYDIPEQVIYVRCSSY 367
gi 75139035  297 HGHgvg------------slELSYRFPEQVSNVHFNGY 322
gi 944079577 328 CGHTWVPSSEGSA-------EL---FPEPVIELFLQGn 355
gi 944258051 287 NGQESFSNNII-----------SSTFPEQVIFVAFRCY 313
gi 474404457 280 GLSKPCASNIISS-------ELTGRFPQEVLFVVFNCc 310
gi 514812071 299 ---DGCPTSYIPS-------ELSCKFPEQIILIHVVCY 326
gi 721647854 306 YEHNVVPSCRGGEsingrklRLSSIFPEPVGLVFLQRH 343
gi 473788562 306 YEHKIVSSCRGDEsnsgnklRLSSIFPEPVCKVFLQRH 343
gi 721647848 306 YEHDSVSSCGGGEsssgnklRLSSIFPEPVCQVSLQRS 343
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap