4ZI8


Conserved Protein Domain Family
Cadherin_2

?
pfam08266: Cadherin_2 
Click on image for an interactive view with Cn3D
Cadherin-like
This cadherin domain is usually the most N-terminal copy of the domain.
Statistics
?
PSSM-Id: 336976
View PSSM: pfam08266
Aligned: 50 rows
Threshold Bit Score: 115.699
Threshold Setting Gi: 149017288
Created: 23-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4ZI8_A        23 IHYEILEERERGFPVGNVVTDLGLDLGSLSARRLRVVSGASRRFFEVNWETGEMFVNDRLDREELCGTLPSCTVTLELVV 102
gi 442570291  33 IRYAIPEELDRGSLVGNLAKDLGFGVGDLPTRNLRVIA--EKKFFTVSPENGNLLVSDRIDREEICGKKSTCVLEFEMVA 110
gi 733908405  19 VVYSIAEGTERGAFVGNVAKDLGINAAALSARKFRMITGSSKQYFNINATTGVLSVNEPIDREQLCELKSTCLLNYELVL 98
gi 149017339  33 VRYSIPEELDRGSVVGNLAKDLGLSVLEVSARKLRVSA--EKMHFSVDSESGDLLVKDRIDREQICKGRRRCELQLEAVL 110
gi 914906461  32 IRYSIPEELAKGSRVGNLAKDLGLSVQELPARKLRVSA---EDYFSVSAESGDLLVSGRIDREKICGRKSECALEFESVI 108
gi 149017331  33 IRYKIPEEMPTGSVVGNLAKDLGFGVQELPTRKLRISS--EKPYFTVSSESGELLVSSRLDREQICGKKLVCSLEFEAVA 110
gi 57529036   29 FVYTVSEEANPGTTVGNLVKDFNLNIQDLEARGFHIVRGPNERYFDVNTKTGVLHVKERIDREEICEQNIKCSLPLEAMI 108
gi 57528959   29 IVYTVSEETNPGTTVGNLAKDLNLNLQDITNRGFQLVSGANKRYFELNSKTGFLHINDRINRDELCGRSLKCSLPLEAIV 108
gi 57528890   29 ISYNVLEEVKPGTTVGNLAKDINLSVKELQSRGFRIVSGSKKQYFSVNVDTGALQVSERIDREELCAGAVACSVNLEAVV 108
gi 53748795   17 IVYSISEEADPGTTVGPIAKDLNLNLHELQLRGFQLVSGPNKRYFDVNLKSGVLLVKERIDRELLCGRSSRCSLEIEAIV 96

                 ..
4ZI8_A       103 EN 104
gi 442570291 111 EK 112
gi 733908405  99 EN 100
gi 149017339 111 EN 112
gi 914906461 109 EN 110
gi 149017331 111 EN 112
gi 57529036  109 Ss 110
gi 57528959  109 Na 110
gi 57528890  109 Ns 110
gi 53748795   97 Ns 98
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap