Conserved Protein Domain Family
HTH_Mga

?
pfam08280: HTH_Mga 
M protein trans-acting positive regulator (MGA) HTH domain
Mga is a DNA-binding protein that activates the expression of several important virulence genes in group A streptococcus in response to changing environmental conditions.
Statistics
?
PSSM-Id: 311953
View PSSM: pfam08280
Aligned: 15 rows
Threshold Bit Score: 45.6808
Threshold Setting Gi: 75430245
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 17369504    2 EKDIKRQIQILEIITSeEKWFTTI--EISKILRCCNKTIMKDISFIKDFLPEDWHIKIKKGK 61
gi 75387188    6 SKKSHRQLELLELLFEhKRWFHRS--ELAELLNCTERAVKDDLSHVKSAFPDLIFHSSTNGI 65
gi 81449555   14 STKVQRQLRLMETLIQnRNWMKLH--ELAEKLGCTERILKSDLNELRIAFPSINIQSSVNGI 73
gi 81372469    7 ESSIESKCQLVVLFFK-TSYLPIT--EVAEKTGLTFLQLNHYCEELNAFFPDSLSMTIQKRM 65
gi 81456265    7 EKNILNKVKLLTLCYD-TPSLSLD--TACNRLHLSPVELKNYCHKLNVLFGHKLSIHIQKER 65
gi 81456349    7 EKDILNQIKLLTLCYDyYPSITLD--KSCHQLGLSELLIRKYCHDLTTLFNSQLSLNIEKST 66
gi 81453795    7 EEKIKLKAYLMTALLD-DGEINLD--HFKTEYALSEKILQGLISELQILYSDFYLVVKSRTM 65
gi 75416117    9 TKQQWRELELIAHLTEhSERMGYKdrELCKVLDSTVSTLQACIANLQ--FMESLGRITYEDG 68
gi 75430245    8 TSQQWRELKLISYVTEnADAIGVKdkELSKALNISMLTLQTCLTNMQ--FMKEVGGITYKNG 67
gi 209539957   7 ESDIIDQKILLAILLT-EKELTMA--AACSQTTLTALKIKQYLRQFNALFKGYLRIELIKSR 65
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap