Conserved Protein Domain Family
DASH_Spc19

?
pfam08287: DASH_Spc19 
Spc19
Spc19 is a component of the DASH complex. The DASH complex associates with the spindle pole body and is important for spindle and kinetochore integrity during cell division.
Statistics
?
PSSM-Id: 311958
View PSSM: pfam08287
Aligned: 87 rows
Threshold Bit Score: 77.6625
Threshold Setting Gi: 0
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121931166    5 LEGCVGSLRNSMQLLDSSINILAEGVNDFPRLA-KVLQTTRHFELISESDLQTAQSALLSEIRPEVDNLLKRVENYLDKL 83
gi 68053299     4 LEQCVNSLEAIVHQLDGSVSRLARNGEASNELCeGILKIKRVFELVPEYDVESARLALFEEVDPMVKTLGDKIEKALIRK 83
40_pfamImport   1 LNQSCLALQNSVNLLQGTLERLKEQGKHSKRLTtTLLQSKRVFELLSEYDLQRARLDLIEDVEPVVDKLCNKLEKSLNKL 80
gi 68053303     5 LDESCVALESSVKLLGKTLERLAEQGEHSRRLTsTLLRSKRVFELVSEYDLQRARLDVIEEVEPVVEKLCSKLEKSLNKL 84
gi 68053291     5 LSEGVDALAACVDDMAKCLTVSKVTTDRSTKLAiNMLQTKRVFQLVSEYDVQRARLDLMEDIEPLLQKLYSKLEKALTKL 84
gi 410076946    5 LESSVVSLESTISLLQDSIETLKTDSKDNNYLTdTMLRCNQVFELIPEFDIERARNDLNEEVEPLIRTLQEKLKKSLSKM 84
gi 365985087    5 LEESVKSFERMIGLLQTTVDTLKHDSEDNTHLTeTLLMSRRVFELVPEYDVQRAKLSLIEEVDPIVKTLEDKLQKSTGKL 84
gi 366989975    5 LDESVECFQDMISQLQGSVDTLKSNSEENNYLTeTMLQSRRVFELVPEYDVQRAKLSLIEEVDPVVKTLEEKLRKSLSKM 84
gi 255716558    5 LSQCCDALESAVELLSGTVSKLENQSNLSNQLTmSLLQPRRVFELIPEYDIQRAKLDLIEEVEPLVKSLSGKLSKSLVKL 84
gi 156842127    5 LEQSVDSLSSAIVMMQRSIEKLKREGEANNSLTgSVLQSKRVFELISGYDVDRAKLAKSEEVDPLVRTLNDKLDKSLGKL 84
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121931166   84 ERREQSLIAKCDLNDGRLGR----------------DSSGATGSRPNS---RamqrgttgkamsaqQELRYKQLRQKKDR 144
gi 68053299    84 RRELENLRQTSELNSLRLSGdlyfsetgidnqdmd-----------------vstdaiaiasatdaELDELRALKARRAE 146
40_pfamImport  81 ERERSTLQQTYELNQLRLNNrfgsgggrvskiq---------------------kypvvmgtstneELERLRELKSRKEA 139
gi 68053303    85 ERERATLQQTYELNQLRLNNrlagsggrrp---------------------------vvmgtstteELGRLREAKQRKAA 137
gi 68053291    85 ERERATLSQTFELNKLRFNNq--------------------ESNPIID---NvksdpvvivsstheELERLKDLKNRKEE 141
gi 410076946   85 TRELDTLKQTFELNQLRLNNtatnnetdlssddinvSTDDVVMASSTN---E--------------ELEELKRLRLKREE 147
gi 365985087   85 QRELDTIQQTCELNKLRLNNnhrtnlttgtsnemdaGNLSTDVVVMGSstnE--------------ELDTLRALKNRKQE 150
gi 366989975   85 QRELETLQQSCELNELRLNNthttgqegdvdmssdnLVVMASSTNE--------------------ELETLKQLKTTKRE 144
gi 255716558   85 ERERDTLQQTLELNSLRLNNqfsgeemsdpdvssdlVIMTSSTTE---------------------ELDQLKKLKAQKAQ 143
gi 156842127   85 QRELDTLQQTYELNKLRLNNnsagsmdvdvstdmviMASSTNEELEEL---K--------------ELK------LTREA 141

                  ....*...
gi 121931166  145 LSYAVETL 152
gi 68053299   147 LQELLDgr 154
40_pfamImport 140 LEYQIQEL 147
gi 68053303   138 LEREIAEv 145
gi 68053291   142 LIQRIQEL 149
gi 410076946  148 LQERLNQL 155
gi 365985087  151 LEERLAQL 158
gi 366989975  145 LELKLAHL 152
gi 255716558  144 LISSIQEi 151
gi 156842127  142 LQRQLQEL 149
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap