Conserved Protein Domain Family
DASH_Spc19

?
pfam08287: DASH_Spc19 
Spc19
Spc19 is a component of the DASH complex. The DASH complex associates with the spindle pole body and is important for spindle and kinetochore integrity during cell division.
Statistics
?
PSSM-Id: 336987
View PSSM: pfam08287
Aligned: 85 rows
Threshold Bit Score: 85.3697
Threshold Setting Gi: 511000978
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121931166   5 LEGCVGSLRNSMQLLDSSINILAEGVNDFPRLA-KVLQTTRHFELISESDLQTAQSALLSEIRPEVDNLLKRVENYLDKL 83
gi 68053303    5 LDESCVALESSVKLLGKTLERLAEQGEHSRRLTsTLLRSKRVFELVSEYDLQRARLDVIEEVEPVVEKLCSKLEKSLNKL 84
gi 68053291    5 LSEGVDALAACVDDMAKCLTVSKVTTDRSTKLAiNMLQTKRVFQLVSEYDVQRARLDLMEDIEPLLQKLYSKLEKALTKL 84
gi 156842127   5 LEQSVDSLSSAIVMMQRSIEKLKREGEANNSLTgSVLQSKRVFELISGYDVDRAKLAKSEEVDPLVRTLNDKLDKSLGKL 84
gi 403213630   4 LKECLWCLEDSVSLLADCNRTLSRNNDDHRFITqKLLQCDREHMLATEFDMERATKDLNEDVQPLMRLKDMLVQRSLPRL 83
gi 444322492   5 LTTCVSLLKSIVNNASSTNEILRSDPNNS---A-DYLKTHRVFELITEYDVEQARIGQIQQQSELLQKLYTKIGGKLNLL 80
gi 363751671   5 LNQSCLALQNSVNLLQGTLERLKEQGKHSKRLTtTLLQSKRVFELLSEYDLQRARLDLIEDVEPVVDKLCNKLEKSLNKL 84
gi 255716558   5 LSQCCDALESAVELLSGTVSKLENQSNLSNQLTmSLLQPRRVFELIPEYDIQRAKLDLIEEVEPLVKSLSGKLSKSLVKL 84
gi 323355678   5 LEQSVLALEGTVXVLKDSVESLKCANEPSTNLAsTMLQTKRVFRLVPEYDVERSKLDLIEEVEPLVRTLGDKLRKSMGRM 84
gi 511000978  25 LQASAQSLSNILSILDTTIKNLDKETAEFSRQT-RLSLFDRPYELVTENDISIAQTEIGKTIDAELDVLIEEAEKEMEKL 103
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121931166  84 ERREQSLIAKCDLNDGRLGR----------------DSSGATGSRPNSRamqrgttgkamsaqQELRYKQLRQKKDRLSY 147
gi 68053303   85 ERERATLQQTYELNQLRLNNrlagsggrrp------------------------vvmgtstteELGRLREAKQRKAALER 140
gi 68053291   85 ERERATLSQTFELNKLRFNNq--------------------ESNPIIDNvksdpvvivsstheELERLKDLKNRKEELIQ 144
gi 156842127  85 QRELDTLQQTYELNKLRLNNnsagsmdvdvstdmviMASSTNEELEELK--------------ELK------LTREALQR 144
gi 403213630  84 KDDLHELEKVKRENEVTLLEmessavyqnestltsgDVNTNPGDVVVGPi-------------SQERLQQLKNLNLEIEQ 150
gi 444322492  81 SGELPKLQQQRALLQARLERnnssirdeeslenaeeLVTMSNATEE-----------------EVSKLQSLKAKRLELQK 143
gi 363751671  85 ERERSTLQQTYELNQLRLNNrfgsgggrvskiq------------------kypvvmgtstneELERLRELKSRKEALEY 146
gi 255716558  85 ERERDTLQQTLELNSLRLNNqfsgeemsdpdvs------------------sdlvimtsstteELDQLKKLKAQKAQLIS 146
gi 323355678  85 QRELDTLQQTYELNDLRLKKnismd-------dddaLNSPDMGQEYEGRxaddvvmmasstneELEELKKLKEKKKQLEN 157
gi 511000978 104 KSEEEELIAKKAEKQMELDElarliklkeaenaqksKSKSKENQRQAQFtp-----------qQKQELRKLDNEKARLEQ 172

                 ....*
gi 121931166 148 AVETL 152
gi 68053303  141 EIAEv 145
gi 68053291  145 RIQEL 149
gi 156842127 145 QLQEL 149
gi 403213630 151 KRQQL 155
gi 444322492 144 QLDsi 148
gi 363751671 147 QIQEL 151
gi 255716558 147 SIQEi 151
gi 323355678 158 KLEIl 162
gi 511000978 173 LLaye 177
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap