Conserved Protein Domain Family
PIGA

?
pfam08288: PIGA 
PIGA (GPI anchor biosynthesis)
This domain is found on phosphatidylinositol n-acetylglucosaminyltransferase proteins. These proteins are involved in GPI anchor biosynthesis and are associated with disease the paroxysmal nocturnal haemoglobinuria.
Statistics
?
PSSM-Id: 311959
View PSSM: pfam08288
Aligned: 22 rows
Threshold Bit Score: 151.636
Threshold Setting Gi: 74601299
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74854431  129 HSYGDRFGIRYVTNGLKVYYIPQAPFYNQSSFPTLYFTFPLFRKILIRERIEIVHCHQAFSTLAHESILHARTMGYSTCF 208
gi 74804742   41 HSYGDRKGIRYMTNGLKVYYVPIKVFYNQVVLPTMICNIPLLRYILLREQIDIVHGHSAFSTLAHETMNVAQLLGLRSVF 120
gi 122114390  40 HAYGDCSGIRYVTGYLKVYYLPIKVCYNQCILPTAVCNVPMLRAVLLRERVEVVHGHSAFSALAHEALMVGSLLGLKTVF 119
gi 124467793  41 HKYQGRSGVRYMTNGLKVYYCPFIPAIQTVVLFTYVGTLPIFRQILLREEIHIVHSHAATSYLGGELLLHAKSMGFKTVF 120
gi 74988637   62 HCYGNRHGVRWMGNGIKVYYLPLQVMTDTVIFPNFIGILPLCRSIIYREKVDIVHGHQAGSPLTQQFILHTKSLGIKTVY 141
gi 74685767  384 HSHPDRLGIHYLEPSLKVYYLPYLPIASSASLPNFLLFLPYFRHIILTENIQLVHGHGALSSLAHEAVIHAPLLGVKAVF 463
gi 156406548  45 HSYGGRKGVRYLTNYLKVYYLPFGVFHNQCILPTLYLDLPILRYIFLRERITIVHGHSAFSTLCHDALLHARTMGMKTIF 124
gi 237834877  60 HYTDGRHGVRYLSNGLKVYYLPFVPVHDNATLPTFFSFFPLIRNILLRERADIVHGHQATSPLAHEASLVARALGMHVVY 139
gi 145345099  36 HAHPGRVGVRWITRGIKVYHVPRVVMYDNCTFPNFLGGFKLFRKTCVREGVTLVHAHQG-CTMSHEGILYARTMGMKCVF 114
gi 156081907  51 HCYNNRHGVRWMGNGIKVYYLPFETYMDVVTFPNIVGTLPLCRNILYRERVDIVHGHQATSALAHQFILHAKSLGLKTIY 130
                         90
                 ....*....|
gi 74854431  209 TDHSLFGFAD 218
gi 74804742  121 TDHSLFGFAD 130
gi 122114390 120 TDHSLFGFAD 129
gi 124467793 121 TDHSLFAFND 130
gi 74988637  142 TDHSLYSFSD 151
gi 74685767  464 TDHSLFGFGD 473
gi 156406548 125 TDHSLFGFAD 134
gi 237834877 140 TDHSLFGFAD 149
gi 145345099 115 TDHSLFGFAD 124
gi 156081907 131 TDHSLYSFSD 140
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap