Conserved Protein Domain Family
AAA_PrkA

?
pfam08298: AAA_PrkA 
PrkA AAA domain
This is a family of PrkA bacterial and archaeal serine kinases approximately 630 residues long. This is the N-terminal AAA domain.
Statistics
?
PSSM-Id: 116881
View PSSM: pfam08298
Aligned: 7 rows
Threshold Bit Score: 528.181
Threshold Setting Gi: 730399
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81634718  24 ISLQEYLLACRDDKSMYATAQERMVDAIGDP---ILVDTSADERLGRIFANRTIKIYPAFS-DFFGMEDTIERIVG-YFR 98
gi 81735249  22 MSMAEYLESCRSDPMKYANAAERLLAAIGEP---QTIDTAKDPRLGRIFLNRTIRTYPAFA-GFYGMEETIERIVG-FFR 96
gi 730399    21 GTFADYLEIIKENPMVAQSAHSRVFNMIKDSgieEI---------------DGRKKYSFFDrELFGLEESLERLVEeYFH 85
gi 81767266  21 GTFLDYLEIVKNNPDVAKLSHKRIYDLIMDKg-fEILRPEENAKIKKIYGNEKIKRYNFFKeDFYGIDTVVMKLMN-YFH 98
gi 75542652  25 CSFLDYLDIVKENPEVCKFAHKRIYDLIIKQgfhI------------VDKNESIKKYNFFGeDFFGIDKTLMKIVN-YFY 91
gi 81732692  19 LSLQEYLELCKQDRSAYASAAERLLLAIGEP---ELVDTSANSRLSRIFSNKVIRRYPAFA-DFHGMEECIDQIVS-YFR 93
gi 82583785  19 FTLQEFLTTCRQDRSAYANAAERLLMAIGEP---VMVDTAQEPRLSRLFSNRVIARYPAFE-EFYGMEDAIEQIVS-YLK 93
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81634718  99 YAAQGLEERKQILYLLGPVGGGKSSLAERLKKLMELR------PIYTLmvdgKISPVFESPLGLFHPERMADLLEDKYGI 172
gi 81735249  97 HAAQGLEERKQILYLLGPVGGGKSSLAERLKSLMEVH------PIYVLkagdELSPVFESPLSLFDPDQLGPMLEEKYGI 170
gi 730399    86 PAAKRLDVRKRILLLMGPVSGGKSTLVTMLKKGLEAYtltdngAVYAI----KGCPMHEDPLHLI-PHHLRDDFYREYGI 160
gi 81767266  99 SASMRGEEARQVLYLVGPVGAGKSSLVESIKRVLETAp-----PVYVL----DGCPMHEEPLHLI-PKHLRKEFGDMLGV 168
gi 75542652  92 AASMEGEESKQVLYLVGPVGSGKSSIVEAIKIALEDSe-----PIYAL----ENCPMREEPLHLI-PNNLRRKFEKELDL 161
gi 81732692  94 HAAQGLEEKKQILYLLGPVGGGKSSLAEKLKQLIEKV------PFYAI----KGSPVFESPLGLFNASEDGAILEEDFGI 163
gi 82583785  94 HAAQGLEEKKQILYLLGPVGGGKSSLAERLKSLMQLV------PIYVLsangERSPVNDHPFCLFNPQEDAQILEKEYGI 167
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81634718 173 ARRRLTGLISPWASKRL-DEVGGDISKFSVVKLMPSRLRQIGIAKTEPGDENNQDVSSLVGKVDIRQLENY-SQADPDAY 250
gi 81735249 171 PRRRLTGLMSPWCYKRL-EAFGGDISQFRVAKIQPSRLRQIAIAKTEPGDENNQDISSLVGKVDIRKLETY-AQNDPDAY 248
gi 730399   161 ---RIEGSLSPLNVMRLeEEYGGRIEDVKVERIFFSEDKRTGIGTFSPSDPKSQDIADLTGSIDFSTIAEYgSESDPRAY 237
gi 81767266 169 ---EIEGDLCPVCKYRLlNEFGGEYEKFPVSTKNFSIRSRKGIGVVPPVDPNNQDTSILTGSIDISKMDMY-PEDDPRIF 244
gi 75542652 162 ---KIEGDLCPVCTYRLrEEFNGEIEKFPVQKIGFSIKERRGVGVVPPVDPNNQDTSVLVGSVDISKMDIY-SEHDPRIF 237
gi 81732692 164 PRRYLSTIMSPWATKRL-AEFGGDISQFKVVKLYPSVLNQIAVAKTEPGDENNQDISALVGKVDIRKLEEF-PQNDADAY 241
gi 82583785 168 PRRYLGTIMSPWAAKRL-HEFGGDITKFRVVKVWPSILQQIAIAKTEPGDENNQDISALVGKVDIRKLEHY-AQNDPDAY 245
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81634718 251 SYSGGLNRTTQGLLEFVEMFKAPIKVLHPLLTATQEGSYNGTENFGAFPFQGTILAHSNESEWLQFKNNRNNEAFLDRIL 330
gi 81735249 249 SYSGGLNRANQGILEFVEMFKAPIKMLHPLLTATQEGNYIGTENIGAIPFTGIILAHSNEAEWASFKANKNNEAFIDRIC 328
gi 730399   238 RFDGELNKANRGMMEFQEMLKCDEKFLWHLLSLTQEGNFKA-GRFALISADELIVAHTNETEYRSFISNKKNEALHSRII 316
gi 81767266 245 SLNGAFNVGNRGLVEFIEVFKNDVEYLHTIITATQEKSIPSPGKGSMIYFDGLIIAHSNEAEWNKFKSDHTNEAILDRIV 324
gi 75542652 238 SLNGAFNVGNRGIVEFIEIFKNDIEYLHSIITATQEKLIPSPGKGSMVYYDGVIIAHSNEGEWNKFKSDPTNEAILDRIV 317
gi 81732692 242 SYSGALCRANQGLMEFVEMFKAPIKVLHPLLTATQEGNYNSTEGLGAIPFTGILLAHSNESEWHSFRNNKKNEAFIDRIY 321
gi 82583785 246 GYSGALCRANQGIMEFVEMFKAPIKVLHPLLTATQEGNYNGTEGISALPFNGIILAHSNESEWVTFRNNKNNEAFLDRVY 325
                       330       340       350       360       370
                ....*....|....*....|....*....|....*....|....*....|....*
gi 81634718 331 VVKVPYCLRVTEEKQIYEKLLRESELVSNPCAPEVLEILSRFTVSTRLVPHENSS 385
gi 81735249 329 VIKVPYVLRVTEEQKIYEKLIQGSELASAPCAPSTLETMARFSVMSRLRKHENST 383
gi 730399   317 VMPVPYNLKVSEEERIYEKMIAESDVADVHIAPHTLKVAAMFSILTRLKEPKRSD 371
gi 81767266 325 KIEVPYCLELSEEIKIYEKILKKSNF-DAHIAPHTMEIASMFAILTRLLPSMKVD 378
gi 75542652 318 KIEVPYCLELDEEKKIYKKILKNSNF-QVHIAPHTIDVAAMFAILTRLNSSEKVD 371
gi 81732692 322 IVKVPYCLRVSDEIKIYDKLLFNSSLAKAHCAPDTLKMLAQFTTLSRLKEPDNSN 376
gi 82583785 326 IVKVPYCLRISEEIKIYEKLLNHSELTHAPCAPGTLETLSRFSILSRLKEPENSS 380
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap